.
The Open Protein Structure Annotation Network
PDB Keyword
.

282629

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction
    Target Id 282629
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2131,TM0759, 289563, 282655 Molecular Weight 27482.25 Da.
    Residues 254 Isoelectric Point 5.66
    Sequence msfiskgakigenlkigrnvviedgvvignnvmighnvvirdgtivgdncvifdgtvlgklpfksaisa vteekefpplkigngvtigancviyrgsvledfvfvgdlvviredvkigpytvigkgvtvenrttigry vkietnayitalstiedycfiapevtftndnflgrteerkkffkgptlkkgariganatilpgvvvged alvaagsvvtrdvpdrkivmgiparvvrdvpeeqlldnqsyykeess
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch