.
The Open Protein Structure Annotation Network
PDB Keyword
.

282413

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 282413
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2084,TM0540 Molecular Weight 30552.81 Da.
    Residues 272 Isoelectric Point 6.18
    Sequence minkhvisekikkaiveanikinpeveeiieryegpfsdiikenyrvskeeklplcqdtgiveffvfig hevkleepieetlnravgevyseypfrysvvsdplferintgtntpaivhifqvkgksleirflvkggg senltvlrmmtptsdvekvkefviehikehgakacpplhvgigiggtadkalllsklaltksfkernkd pkyaglekelekelnflgigfqglgkgitvysvhiehfpthiatlpvavsvdcylcrrgkvtfed
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary

     

    Ligand Summary

     

     
     

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     TM0540.pdb
    No description
    77.84 kB00:17, 27 Jun 2009AdminActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch