The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 282189
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2033,TM0313, _0087.001827_, _0112.000092_, _0002.001809_, 84866 Molecular Weight 36169.87 Da.
    Residues 319 Isoelectric Point 5.71
    Sequence meyrkvgkwgvkiselslgswltfgkqldldtatevvkkafnsginffdtaeayaggiaeamlgkilkn frredlvvstkifwggsgpndlglskkhllegtwnslkrlqmdyvdilychrpdpnvpmeevvfamdyi lreglalywgtsewsakeieeahrvckelgvmppiveqpqynmfvrervekeyaplyekygmglttysp lasgllsgkynngipegsrlatfpqvrkwleeggllnektfkklrklqniadqlgaslpqlaiawilkn knvssvilgvsrpeqleenlkaveikekltedvmeeiekilne
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Model TM0313
    generated 12/2008
    Google Scholar output for

    Protein Summary

    Ligand Summary





    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch