.
The Open Protein Structure Annotation Network
PDB Keyword
.

282086

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Site JCSG
    Status Crystallized
    Target Id 282086
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1991,TM0206 Molecular Weight 20044.21 Da.
    Residues 171 Isoelectric Point 6.38
    Sequence mmikvlideetlkkrikelareieeyylgktdtihavcilkgsihffsdlmlnirklnvkysfihvssy qgtsstgkirvkswidesihdeyvllvedivdtgltlqhivrylkkynprdfrivsliektvhdhgipl dfvgfrvddkflvgygldidekyrnlpyigyve
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0206
    generated 12/2008
    Google Scholar output for

    Protein Summary


    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch