.
The Open Protein Structure Annotation Network
PDB Keyword
.

282052

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 282052
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1982,TM0172, 3.40.640.10, 282260, 83918 Molecular Weight 44847.31 Da.
    Residues 404 Isoelectric Point 5.72
    Sequence mntgemkinwvsrympllnkiaeeysrekplsgftvgmsihleaktaylaitlsklgakvvitgsnpls tqddvaealrskgitvyarrthdesiyrenlmkvlderpdfiiddggdltvishtereevlenlkgvse etttgvrrlkaleetgklrvpviavndskmkylfdnrygtgqstwdaimrntnllvagknvvvagygwc grgialraaglgarvivtevdpvkaveaimdgftvmpmkeavkiadfvitasgntdvlskedilslkdg avlanaghfnveipvrvleeiavekfearpnvtgytlengktvfllaegrlvnlaagdghpveimdlsf alqifavlyllenhrkmspkvymlpdeidervarmkldslgvkideltekqrrylrswq
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0172
    generated 12/2008
    Google Scholar output for

    Protein Summary


    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch