The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 282023
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1974,TM0143, 83909, 89873, 282818 Molecular Weight 51250.32 Da.
    Residues 450 Isoelectric Point 5.88
    Sequence mkkvlivddskfwrlvvsdivknikkdveillaeggmdglqkalnhrpdyfiidynmpdfsglylsvvl remkafkdsgiviltassdtinsfwakksganlfinkgkkeeiekelqvflntpyeslkncessesgnv fhivekrlkreilekeilsylkysrderyvisllvmlfrnfsmfgsfrallistsegriysfgkpvdke vlrkflisklekptspsfwsfhgafgegsisddnisavvkddgtelgvvlfedvenpfllrsaledsls slmvlfrnlndfrdyviasetdgltglfnkraimrfleevlrsekniavammdiddfkkindtfghpvg devlrvvanilretvkigkvgryggeefmvvfetgerdavvktmdnimenirnfdwqkifgsekkvtls ggvafskkesspvelieeadkklytakrsgkdryvi
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary





    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch