.
The Open Protein Structure Annotation Network
PDB Keyword
.

282005

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Site JCSG
    Status Crystallized
    Target Id 282005
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1966,TM0124 Molecular Weight 27584.49 Da.
    Residues 240 Isoelectric Point 6.67
    Sequence mkivevknltyrindfeilknvtfsveegefvgiigpngagkttlvrilvgdiknyegkvevrgkigyl pqlhqvqrefpitvkefaamgmygryrkidwekvrstlkdvgilhkendpiknlsggefqrlslarall sdpdilvldepeagvdemgkasfyellnrlrkeknitvimvshdigmvfkecstimclnrtlhchgpte tinpedlkkiftdfdiwirgtrhyeiyhgrerd
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch