.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ztv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of (29342463) from Enterococcus faecalis V583 at 3.10 A resolution. To be published
    Site JCSG
    PDB Id 1ztv Target Id 357242
    Related PDB Ids 1vpy 
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS1377,EF0366, _0050.001329_, 289807, 289432 Molecular Weight 32134.14 Da.
    Residues 277 Isoelectric Point 5.81
    Sequence mirlgltsfsehdyltgkkrstlyeyashlplvemdtayygippkervaewvkavpenfrfvmkvysgi scqgewqtyyaseeemitaflesmaplieskklfaflvqfsgtfgctkenvaylqkirhwfkdlpiaie lrnnswyqpnfvkqmlqfmkenqfslvivdepqiptnpvpfypyvtnpnlvlfrfhgrnaagwlandae wrkkrtlyhyntqeiadlseavlkmsqeakevgvifnnnsggdaaenalqmqkvlnlsyddlnpkqldlf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.10 Rfree 0.224
    Matthews' coefficent 4.08 Rfactor 0.191
    Waters 12 Solvent Content 69.59

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ztv

    Protein Summary

    The EF0366 gene from Enterococcus faecalis V583 codes for the NP_814157 protein from the DUF72 family (PF01904).

    SCOP classifies 1ztv in the alpha/beta class, TIM beta/alpha barrel fold, TM1631-like superfamily. DALI returns a significant hit with TM1631 PDB:1vpq (Z=29), and weak hits with mannonate dehydratases 3fvm, 3bdk, 3ban (Z=12).

    We refer the interested reader to the entry 1vpq entry for more details.

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch