.
The Open Protein Structure Annotation Network
PDB Keyword
.

1z9f

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of a single-stranded DNA-binding protein (TM0604) from Thermotoga maritima at 2.60 A resolution. Proteins 63 256-260 2006
    Site JCSG
    PDB Id 1z9f Target Id 282477
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1220,TM0604, 89398 Molecular Weight 16297.55 Da.
    Residues 141 Isoelectric Point 4.80
    Sequence msffnkiiligrlvrdpeerytlsgtpvttftiavdrvprknapddaqttdffrivtfgrlaefartyl tkgrlvlvegemrmrrwetptgekrvspevvanvvrfmdrkpaetvseteeeleipeedfssdtfsede ppf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.3
    Matthews' coefficent 3.28 Rfactor 0.223
    Waters 14 Solvent Content 62.23

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1z9f
    1. The JCSG MR pipeline: optimized alignments, multiple models and parallel searches
    R Schwarzenbacher, A Godzik - Section D: Biological , 2007 - scripts.iucr.org
     
    2. Single-stranded DNA-binding protein complex from Helicobacter pylori suggests an ssDNA-binding surface
    KW Chan, YJ Lee, CH Wang, H Huang - Journal of molecular , 2009 - Elsevier
     
    3. Crystal structure of a single_stranded DNA_binding protein (TM0604) from Thermotoga maritima at 2.60 resolution
    M DiDonato, S Sri Krishna - Proteins: Structure, , 2006 - Wiley Online Library
     
    4. Autoindexing with outlier rejection and identification of superimposed lattices
    NK Sauter, BK Poon - Journal of Applied Crystallography, 2010 - scripts.iucr.org
     
    5. X-ray and molecular-dynamics studies on Mycobacterium leprae single-stranded DNA-binding protein and comparison with other eubacterial SSB structures
    PS Kaushal, P Singh, A Sharma - Section D: Biological , 2010 - scripts.iucr.org
     
    6. Structure of the single-stranded DNA-binding protein from Streptomyces coelicolor
    Z Stefanic, D Vujaklija, M Luic - Acta Crystallographica Section D: , 2009 - scripts.iucr.org
     
    7. Single-Stranded DNA-Binding Protein Complex
    YJ Sun - J. Mol. Biol, 2009 - 144.206.159.178
     

    Protein Summary

    Single-strand binding protein - TM0604 (SSB, Helix-destabilizing protein) from Thermotoga maritima (PubMed:16435371) plays essential roles in DNA replication, recombination, and repair.

    The functions of SSB protein from Thermotoga maritima may be interdependent with its genomic neighbours (RS18_THEMA "30S ribosomal protein S18" and RS6_THEMA "30S ribosomal protein S6") and proteins with the similar phylogenetic cooccurrence (RL20_THEMA "50S ribosomal protein L20", RL27_THEMA "50S ribosomal protein L27", NUSG_THEMA "Transcription antitermination protein nusG", Q9X1A0 "Hypothetical protein TM1380").

    TM0604 has OB-fold (SCOP sunid:50198).

    Similar structures: 1s3oA, 1x3eA, 1ue1A, 2cwaA, 1se8A, 1v1qA, 2fxqA,  and 1quqA.


    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch