.
The Open Protein Structure Annotation Network
PDB Keyword
.

1z8h

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Putative lipase from the G-D-S-L family (17135349) from Nostoc sp. PCC 7120 at 2.02 A resolution. To be published
    Site JCSG
    PDB Id 1z8h Target Id 354318
    Related PDB Ids 1vjg 
    Molecular Characteristics
    Source Nostoc sp. pcc 7120
    Alias Ids TPS1329,17135349 Molecular Weight 23594.68 Da.
    Residues 206 Isoelectric Point 8.30
    Sequence mtkqsktqiricfvgdsfvngtgdpeclgwtgrvcvnankkgydvtyynlgirrdtssdiakrwlqevs lrlhkeynslvvfsfglndttlengkprvsiaetikntreiltqakklypvlmispapyieqqdpgrrr rtidlsqqlalvcqdldvpyldvfpllekpsvwlheakandgvhpqaggytefarivenwdawlnwfr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.02 Rfree 0.19469
    Matthews' coefficent 2.30 Rfactor 0.15466
    Waters 819 Solvent Content 46.19

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1z8h
    1. Crystal structure of a full-length autotransporter
    B Van Den Berg - Journal of molecular biology, 2010 - Elsevier
     
    2. Biochemical characterization of Alr1529, a novel SGNH hydrolase variant from Anabaena sp. PCC 7120
    K Bakshy, SN Gummadi, N Manoj - et Biophysica Acta (BBA)-Proteins & , 2009 - Elsevier
     
    3. Modeling structural heterogeneity in proteins from X-ray data
    A Dhanik, H Van Den Bedem, A Deacon - Algorithmic Foundation of , 2009 - Springer
     
    4. MS93. P08
    DT Nair, N Sivakumara, D Jaina - Foundations of , 2011 - scripts.iucr.org
     
    5. Prdiction des rsidus impliqus dans le noyau du repliement et classification structurale de fragments protiques en interaction.
    N Prudhomme - 2009 - hal.archives-ouvertes.fr
     

    Protein Summary

    The gene alr1529 from Nostoc sp. encodes the NP_485569 protein, a putative GDSL-like lipase PF00657 EC:3.1.1.1, and a member of the SGNH hydrolase subfamily.  SGNH hydrolases are a diverse family of lipases and esterases.Its genome context suggests a possible functional link (score 0.87) with the aminoglycoside N3'-acetyltransferase.

    1z8h structure is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.  The protein belongs to the class of alpha and beta (a+b) proteins and reveals a flavodoxin-like fold type SCOP52171.  This enzyme has a related structure entry in 1VJG. DALI top hits are with the lipase 1yzf (Z=22), the esterase 2q0q (Z=21), and the arylesterase 3dci (Z=20).

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch