The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of propionyl-CoA carboxylase, beta subunit (TM0716) from THERMOTOGA MARITIMA at 2.30 A resolution. To be published
    Site JCSG
    PDB Id 1vrg Target Id 282586
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1226,TM0716, 89312 Molecular Weight 56411.83 Da.
    Residues 515 Isoelectric Point 5.64
    Sequence mslrdkieelkkiekeieqgggpekvekqhragkltawerlellldpgtfveidkfvehrntyfgldkv klprdgvitgvgeingrkvavfsqdftvmggslgemhakkivklldlalkmgipvigindsggariqeg vdalagygeiflrntlasgvvpqitviagpcaggavyspaltdfivmvdqtarmfitgpnvikavtgee isqedlggamvhnqksgnahfladndekamslvrtllsylpsnnaeeppvedpdtsletpedildilpd npnkgydvrdvikrvvdhgeffevqpyfaknivigfariqgktvgivanqpsvlagvldidssdkaarf irfldafnipiltfvdtpgylpgvaqehggiirhgakllyayseatvpkitvilrkayggayiamgskh lgadmvlawpsaeiavmgpegaaniifkreieassnpeetrrklieeykqqfanpyiaasrgyvdmvid pretrkyimralevcetkveyrpkkkhgnipl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.30 Rfree 0.2098
    Matthews' coefficent 2.46 Rfactor 0.154
    Waters 1439 Solvent Content 49.58

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information


    Google Scholar output for 1vrg
    1. Template-free detection of macromolecular complexes in cryo electron tomograms
    M Xu, M Beck, F Alber - Bioinformatics, 2011 - Oxford Univ Press
    2. QSCOP-BLASTfast retrieval of quantified structural information for protein sequences of unknown structure
    SJ Suhrer, M Gruber, MJ Sippl - Nucleic acids research, 2007 - Oxford Univ Press

    Protein Summary

    The TM0716 gene from Thermotoga maritima encodes the transferase domain of propionyl-CoA carboxylase (PF01039, COG0825, EC The structure adopts a CLP/crotonase fold and shows a strong similarity with a homolog from Propionibacterium freudenreichii (PDB ids: 1on3, 1on9) with a main-chain rmsd of 0.8 Å over 514 residues and a sequence identity of 57%. Similar hits were obtained for homologs from Streptomyces coelicor (PDB id: 1x0u) and Sulfolobus tokodaii (PDB id: 1xnv). For more details on the structure and catalytic mechanism see Diacovich 2004 and Hall 2004.



    Ligand Summary





    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch