.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vrd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Inosine-5'-monophosphate dehydrogenase (TM1347) from THERMOTOGA MARITIMA at 2.18 A resolution. To be published
    Site JCSG
    PDB Id 1vrd Target Id 283208
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1278,TM1347, 282192 Molecular Weight 52011.54 Da.
    Residues 482 Isoelectric Point 6.37
    Sequence mkealtfddvllvpqysevlpkdvkidtrltrqiriniplvsaamdtvteaalakalareggigiihkn ltpdeqarqvsivkktengiiydpitvtpdmtvkeaidlmaeykigglpvvdeegrlvglltnrdvrfe knlskkikdlmtpreklivappdislekakeilhqhrieklplvskdnklvglitikdimsviehpnaa rdekgrllvgaavgtspetmerveklvkagvdvividtahghsrrvietlemikadypdlpvvagnvat pegtealikagadavkvgvgpgsicttrvvagvgvpqltavmecsevarkydvpiiadggirysgdivk alaagaesvmvgsifagteeapgetilyqgrkykayrgmgslgamrsgsadrygqegenkfvpegiegm vpykgtvkdvvhqlvgglrsgmgyigartikelqekavfvkitpagvkeshphdiiitkespnywvqa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.18 Rfree 0.25759
    Matthews' coefficent 3.80 Rfactor 0.21653
    Waters 206 Solvent Content 67.42

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vrd
    1. Inosine monophosphate dehydrogenase (IMPDH) as a target in drug discovery
    Q Shu, V Nair - Medicinal research reviews, 2008 - Wiley Online Library
     
    2. SPINE workshop on automated X-ray analysis: a progress report
    M Bahar, C Ballard, SX Cohen, KD Cowtan - Section D: Biological , 2006 - scripts.iucr.org
     
    3. Autoindexing with outlier rejection and identification of superimposed lattices
    NK Sauter, BK Poon - Journal of Applied Crystallography, 2010 - scripts.iucr.org
     
    4. Crystal structure of human guanosine monophosphate reductase 2 (GMPR2) in complex with GMP
    J Li, Z Wei, M Zheng, X Gu, Y Deng, R Qiu - Journal of molecular , 2006 - Elsevier
     
    5. Bacillus anthracis IMP Dehydrogenase in Action: The First Bacterial Series of Structures of Phosphate Ion-, Substrate-and Product-bound Complexes
    M Makowska-Grzyska, Y Kim, R Wu, R Wilton - Biochemistry, 2012 - ACS Publications
     

    Protein Summary

    The gene TM1347 from Thermotoga maritima encodes the catalytic domain of inosine-5'-monophosphate dehydrogenase PF00478 (IMPDH).  IMPDH catalyzes the NAD-dependent oxidation of inosine 5'-monophosphate (IMP) to xanthosine 5' monophosphate (XMP). It is a rate-limiting step in the de novo synthesis of the guanine nucleotides. There is often a CBS domain PF00571 inserted in the middle of this domain, which is proposed to play a regulatory role.  Members of this family contain a TIM barrel structure.   IMPDH is a key enzyme in the regulation of cell proliferation and differentiation.  The mammalian form of the enzyme is a possible target for cancer chemotherapy.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch