.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vr5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Oligopeptide ABC transporter, periplasmic oligopeptide-binding (TM1223) from THERMOTOGA MARITIMA at 1.73 A resolution. To be published
    Site JCSG
    PDB Id 1vr5 Target Id 358463
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1392,TM1223 Molecular Weight 61613.04 Da.
    Residues 535 Isoelectric Point 4.99
    Sequence ernktlywggalwsppsnwnpftpwnavagtiglvyeplflydplndkfepwlaekgewvsnneyvltl rkglrwqdgvpltaddvvftfeiakkytgisyspvwnwlgriervdertlkfvfsdpryqewkqmlint pivpkhiwenkteeevlqaanenpvgsgpyyveswaddrcvfkkngnwwgirelgydpkperivelrvl snnvavgmlmkgeldwsnfflpgvpvlkkaygivtwyenapymlpantagiyinvnkyplsipefrram ayainpekivtrayenmvtaanpagilplpgymkyypkevvdkygfkydpemakkildelgfkdvnkdg fredpngkpfkltiecpygwtdwmvsiqsiaedlvkvginvepkypdyskyaddlyggkfdlilnnftt gvsatiwsyfngvfypdaveseysysgnfgkyanpevetlldelnrsnddakikevvaklseillkdlp fiplwyngawfqaseavwtnwpteknpyavpigwngwwqltgiktlfgieak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.73 Rfree 0.18161
    Matthews' coefficent 2.79 Rfactor 0.15164
    Waters 1099 Solvent Content 55.56

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vr5
    1. The Buccaneer software for automated model building. 1. Tracing protein chains
    K Cowtan - Acta Crystallographica Section D: Biological , 2006 - scripts.iucr.org
     
    2. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    3. Structural and Functional Insights into Aeropyrum pernix OppA, a Member of a Novel Archaeal OppA Subfamily
    M Balestrieri, M Gogliettino, I Fiume - Journal of , 2011 - Am Soc Microbiol
     
    4. Structural model and ligand interactions of the Xanthomonas axonopodis pv. citri oligopeptide-binding protein
    A Moutran, A Balan, LCS Ferreira - Genetics and , 2007 - funpecrp.com.br
     
    5. Crystal Structures of an Oligopeptide-Binding Protein from the Biosynthetic Pathway of the [beta]-Lactamase Inhibitor Clavulanic Acid
    AK Mackenzie, K Valegrd, A Iqbal, MEC Caines - Journal of molecular , 2010 - Elsevier
     
    6. Structure and ligand binding of the soluble domain of a Thermotoga maritima membrane protein of unknown function TM1634
    CJ McCleverty, L Columbus, A Kreusch - Protein , 2008 - Wiley Online Library
     
    7. Carbohydrate utilization pathway analysis in the hyperthermophile Thermotoga maritima
    SB Conners - 2006 - repository.lib.ncsu.edu
     
    8. Exploring the structurial diversity and engineering potential of thermophilic periplasmic binding proteins
    MJ Cuneo - 2007 - dukespace.lib.duke.edu
     

    Protein Summary

    The gene TM1223 from Thermotoga maritima encodes oligopeptide ABC transporter, a member of the bacterial extracellular solute-binding proteins family 5 PF00496.  The protein belongs to the class of alpha and beta (a+b) proteins and reveals periplasmic binding protein-like II fold type SCOP53849. Periplasmic binding proteins (PBPs) constitute a protein superfamily that binds a wide variety of ligands. In prokaryotes, PBPs function as receptors for ATP-binding cassette or tripartite ATP-independent transporters and chemotaxis systems.  The structure of the homologous protein from the same family from the same organism is available 2O7I.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch