.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vqr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of virulence factor CJ0248 from Campylobacter jejuni at 2.25 A resolution reveals a new fold. Proteins 62 292-296 2006
    Site JCSG
    PDB Id 1vqr Target Id 356952
    Molecular Characteristics
    Source Campylobacter jejuni subsp. jejuni nctc 11168
    Alias Ids TPS1372,6967725, 289776, 289773 Molecular Weight 31959.14 Da.
    Residues 285 Isoelectric Point 5.84
    Sequence migdmnelllksvevlpplpdtvsklrkyvseansnietmkvaeiissdplmtakllqlanspyygftr eittinqvitllgvgniinivmadsirdnfkidvspyglntqnflktcneeatfianwlndedkklshl lvpcamllrlgivifsnfliqnhkdkdflaflnknenlalaeneflgvdhisflgfllhrwnfddvlie sicfvrtphaarekvkksayalaitdhlfaphdgsspfnakaavallkeaktqginfdlnnllsklpnk akenlnked
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.25 Rfree 0.23286
    Matthews' coefficent 2.58 Rfactor 0.19312
    Waters 193 Solvent Content 51.91

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vqr
    1. The Buccaneer software for automated model building. 1. Tracing protein chains
    K Cowtan - Acta Crystallographica Section D: Biological , 2006 - scripts.iucr.org
     
    2. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    3. Crystal structure of virulence factor CJ0248 from Campylobacter jejuni at 2.25 resolution reveals a new fold
    Q Xu, R Schwarzenbacher, D McMullan - Proteins: Structure, , 2006 - Wiley Online Library
     

    Protein Summary

    The CJ0248 gene of Campylobacter jejuni encodes a putative enzymatic output domain (HDOD) involved in signal-transduction (COG1639, Pfam08668, PubMed:16287129), and shows distant relationship to the widespread HD phosphohydrolase (Pfam01966) domain. However, the protein encoded by CJ0248 lacks conservation of the key metal-binding residues of the typical HD domain required for phosphatase or phosphodiesterase activity (PubMed:16740923) and its function remains unknown.

    SCOP classifies 1vqr in the all alpha class, HD-domain/PDEase-like superfamily, modified HD domain family. A DALI search identifies as top hits the MMOQ response regulator PDB:3ljx (Z=19) and the HDOD protein PDB:3hc1 (Z=12).

    CJ0248 is one of 22 Campylobacter jejuni genes shown to be necessary for C. jejuni colonization of chicken gastrointestinal tract. Campylobacter jejuni is the leading cause of bacterial gastroenteritis in humans in developed countries throughout the world. Consumption or handling of poultry meats is a prevalent source of C. jejuni for infection in humans (Hendrixson and DiRita, Mol. Microb. 52:471).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch