The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of phosphoribosylformyl-glycinamidine synthase II, PurS subunit (TM1244) from Thermotoga maritima at 1.90 A resolution. Proteins 65 249-254 2006
    Site JCSG
    PDB Id 1vq3 Target Id 283109
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1271,TM1244 Molecular Weight 9638.72 Da.
    Residues 82 Isoelectric Point 5.91
    Sequence mplfkfaidvqyrsnvrdprgetiervlreekglpvkklrlgksihleveaenkekayeivkkaceell vnpvveeyevrel
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.90 Rfree 0.2345
    Matthews' coefficent 2.29 Rfactor 0.17783
    Waters 301 Solvent Content 45.84

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information


    Google Scholar output for 1vq3
    1. The JCSG MR pipeline: optimized alignments, multiple models and parallel searches
    R Schwarzenbacher, A Godzik - Section D: Biological , 2007 - scripts.iucr.org
    2. Formylglycinamide Ribonucleotide Amidotransferase from Thermotoga maritima: Structural Insights into Complex Formation
    M Morar, AA Hoskins, JA Stubbe, SE Ealick - Biochemistry, 2008 - ACS Publications
    3. Crystal structure of phosphoribosylformyl_glycinamidine synthase II, PurS subunit (TM1244) from Thermotoga maritima at 1.90 resolution
    II Mathews, S Krishna - Proteins: Structure, , 2006 - Wiley Online Library

    Protein Summary

    The TM1244 from T. maritima  encodes PurS subunit of phosphoribosylformylglycinamidine synthase and belongs to COG1828.

    The TM1244 functions are interdependent with PurQ [PURQ_THEMA] -  Phosphoribosylformylglycinamidine synthase I (EC; FGAM synthase I).

    The TM1244 monomer belongs to the PurS-like SCOP fold.

    Analysis of the crystallographic packing of TM1244 using the PQS server {Henrick, 1998 #73} indicates that a tetramer is the biologically relevant form.

    Ligand Summary





    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch