.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vq1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of N5-glutamine methyltransferase, HemK(EC 2.1.1.-) (TM0488) from Thermotoga maritima at 2.80 A resolution. To be published
    Site JCSG
    PDB Id 1vq1 Target Id 282361
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1209,TM0488, 84911 Molecular Weight 31607.68 Da.
    Residues 282 Isoelectric Point 5.43
    Sequence mdtrknvsgaerkiwslirdcsgklegvtetsvlevllivsrvlgirkedlflkdlgvspteekrilel vekrasgyplhyilgekefmglsflveegvfvprpeteelvelalelirkygiktvadigtgsgaigvs vakfsdaivfatdvsskaveiarknaerhgvsdrffvrkgeflepfkekfasiemilsnppyvkssahl pkdvlfeppealfggedgldfyreffgrydtsgkivlmeigedqveelkkivsdtvflkdsagkyrfll lnrrss
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.27281
    Matthews' coefficent 2.85 Rfactor 0.20824
    Waters 7 Solvent Content 56.55

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vq1
    1. Prediction of protein structure from ideal forms
    WR Taylor, GJ Bartlett, V Chelliah - Proteins: Structure, , 2008 - Wiley Online Library
     
    2. Functional site prediction selects correct protein models
    V Chelliah, WR Taylor - BMC bioinformatics, 2008 - biomedcentral.com
     
    3. Helix_sheet packing in proteins
    C Hu, P Koehl - Proteins: Structure, Function, and , 2010 - Wiley Online Library
     

    Protein Summary

    The TM0488 gene from Thermotoga maritima encodes a N5-glutamine methyltransferase, HemK (EC 2.1.1.-)

    (PF01575, COG2890). The TM0488 structure adopts an S-adenosyl-L-methionine dependent methyltransferase fold and shows strong structural similarity (main-chain rmsd 0.4 Å over 266 residues) with N5-glutamine methyltransferase HemK from Thermotoga maritima (PDB id: 2nv8, 1sg9). See Schubert 2003 for more details on the structure and mechanism.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch