.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vpz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of the global regulatory protein CsrA from Pseudomonas putida at 2.05 A resolution reveals a new fold. Proteins 61 449-453 2005
    Site JCSG
    PDB Id 1vpz Target Id 357779
    Molecular Characteristics
    Source Pseudomonas aeruginosa pao1
    Alias Ids TPS1378,NP_249596.1, 289680, 289781 Molecular Weight 6908.66 Da.
    Residues 61 Isoelectric Point 6.72
    Sequence mliltrrvgetlmvgddvtvtvlgvkgnqvrigvnapkevavhreeiyqriqkekdqepnh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.05 Rfree 0.27545
    Matthews' coefficent 2.71 Rfactor 0.21848
    Waters 23 Solvent Content 54.29

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vpz
    1. Diversity of structure and function of response regulator output domains
    MY Galperin - Current opinion in microbiology, 2010 - Elsevier
     
    2. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    3. Solution structure of the carbon storage regulator protein CsrA from Escherichia coli
    P Gutirrez, Y Li, MJ Osborne - Journal of , 2005 - Am Soc Microbiol
     
    4. Crystal structure of the global regulatory protein CsrA from Pseudomonas putida at 2.05 resolution reveals a new fold
    C Rife, R Schwarzenbacher - Proteins: Structure, , 2005 - Wiley Online Library
     
    5. Structural classification of proteins and structural genomics: new insights into protein folding and evolution
    A Andreeva, AG Murzin - Acta Crystallographica Section F: Structural , 2010 - scripts.iucr.org
     
    6. The Buccaneer software for automated model building. 1. Tracing protein chains
    K Cowtan - Acta Crystallographica Section D: Biological , 2006 - scripts.iucr.org
     

    Protein Summary

    Gene csrA from Pseudomonas aeruginosa  translates into the NP_249596 protein belonging to the global regulator family CsrA (carbon storage regulator) (PF02599), CsrA is an RNA-binding protein representative of a new class of regulators that facilitate specific mRNA decay of carbohydrate metabolism genes (PubMed:[Ref], [Ref]). The active dimerization form is dimeric.

    CsrA (1vpz) and similar RsmA from Yersinia enterocolitica (PDB:2bti; DALI Z-score=10) have a new fold (termed by SCOP as CsrA-like), where the CsrA monomer contains five consecutive antiparallel beta-strands followed by one alpha-helix. Other protein structures of this fold have been determined, such as RsmE from Pseudomonas fluorescens PDB:2jpp (76% seq. id.), CsrA from E. coli PDB:1y00 (47% seq. id.), and very interestingly, the biological unit of 1vpz (that is, chains A and B) is also found as half of the JCSG -determined cupin structure PDB:2oa2 (80 equivalent residues, 2.34Å rmsd, 11% sequence identity according to TopMatch, see Topsan entry.).

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    2. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch