The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of DNA polymerase III, beta subunit (TM0262) from Thermotoga maritima at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 1vpk Target Id 282139
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1195,TM0262, _0032.000316_, _0106.000668_, 84862 Molecular Weight 40945.89 Da.
    Residues 366 Isoelectric Point 4.66
    Sequence mkvtvttlelkdkitiaskalakksvkpilagflfevkdgnfyicatdletgvkatvnaaeisgearfv vpgdviqkmvkvlpdeitelslegdalvissgstvfrittmpadefpeitpaesgitfevdtslleemv ekvifaaakdefmrnlngvfwelhknllrlvasdgfrlalaeeqieneeeasfllslksmkevqnvldn tteptitvrydgrrvslstndvetvmrvvdaefpdykrvipetfktkvvvsrkelreslkrvmviaskg sesvkfeieenvmrlvskspdygevvdevevqkegedlviafnpkfiedvlkhieteeiemnfvdstsp cqinpldisgylyivmpirla
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.23207
    Matthews' coefficent 2.73 Rfactor 0.19632
    Waters 164 Solvent Content 54.63

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information


    Google Scholar output for 1vpk
    1. The JCSG MR pipeline: optimized alignments, multiple models and parallel searches
    R Schwarzenbacher, A Godzik - Section D: Biological , 2007 - scripts.iucr.org

    Protein Summary

    The TM0262 gene from Thermotoga maritima encodes the C-terminal domain of the beta subunit of DNA polymerase III (PFAM:PF02768, COG: COG0592, EC: The TM0262 structure adopts a DNA clamp fold and shows strong structural similarity (main-chain rmsd 1.8 Å over 346 residues with 27% sequence identity) with the beta subunit from DNA polymerase III from Escherichia coli (PDB ids: 3dlf, 1mmi) (Oakley 2003) and Streptococcus pneumoniae (PDB:2awa). For more details on the structure and function of TM0262 see Georgesku 2008.

    Ligand Summary





    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch