The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (TM1393) from Thermotoga maritima at 2.67 A resolution. To be published
    Site JCSG
    PDB Id 1vpa Target Id 283254
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1284,TM1393, 282352 Molecular Weight 25368.95 Da.
    Residues 222 Isoelectric Point 6.94
    Sequence mnvaillaagkgermsenvpkqfleiegrmlfeyplstflkseaidgvvivtrrewfevvekrvfhekv lgiveggdtrsqsvrsaleflekfspsyvlvhdsarpflrkkhvsevlrraretgaatlalknsdalvr vendrieyiprkgvyriltpqafsyeilkkahenggewaddtepvqklgvkialvegdplcfkvtfked lelariiarewerip
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.67 Rfree 0.24783
    Matthews' coefficent 3.18 Rfactor 0.19879
    Waters 119 Solvent Content 61.04

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information


    Google Scholar output for 1vpa
    1. The JCSG MR pipeline: optimized alignments, multiple models and parallel searches
    R Schwarzenbacher, A Godzik - Section D: Biological , 2007 - scripts.iucr.org
    2. The crystal structure of a plant 2C_methyl_D_erythritol 4_phosphate cytidylyltransferase exhibits a distinct quaternary structure compared to bacterial homologues and
    M Gabrielsen, J Kaiser, F Rohdich, W Eisenreich - FEBS , 2006 - Wiley Online Library
    3. Synthesis of CDP-activated ribitol for teichoic acid precursors in Streptococcus pneumoniae
    S Baur, J Marles-Wright, S Buckenmaier - Journal of , 2009 - Am Soc Microbiol
    4. Structure-based drug design targeting biosynthesis of isoprenoids: a crystallographic state of the art of the involved enzymes
    J Ruyck, J Wouters - Current Protein and Peptide Science, 2008 - ingentaconnect.com
    5. Homology modeling of Mycobacterium tuberculosis 2C-methyl-d-erythritol-4-phosphate cytidylyltransferase, the third enzyme in the MEP pathway for isoprenoid
    C Obiol-Pardo, A Cordero, J Rubio-Martinez - Journal of molecular , 2010 - Springer
    6. Structural and functional studies of mycobacterial IspD enzymes
    C Bjorkelid, T Bergfors, LM Henriksson - Section D: Biological , 2011 - scripts.iucr.org
    7. 2C-methyl-D-erythritol-4-phosphate cytidylyltransferase, the third enzyme in the MEP pathway for isoprenoid biosynthesis
    C Obiol-Pardo, A Cordero, J Rubio-Martinez, S Imperial - infection, 2009 - Springer

    Protein Summary

    The gene TM1393 from Thermotoga maritima encodes 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (the other name is 4-diphosphocytidyl-2-c-methylerythritol synthetase (CDP-ME synthetase)) E.C.  This enzyme belongs to the family of transferases, specifically those transferring phosphorus-containing nucleotide groups (nucleotidyltransferases).  This family of enzymes is involved in mevalonate-independent isoprenoid production  in a number of prokaryotic organisms, algae, the plant plastids and the malaria parasite.  Because vertebrates synthesize isoprenoid precursors using a mevalonate pathway, CDP-ME synthetase and other enzymes of the mevalonate-independent pathway for isoprenoid production represent attractive targets for the structure-based design of selective antibacterial, herbicidal and antimalarial drugs [Ref].  The crystal structure of the homologous E. coli enzyme has been previously described 1I52.  The biological unit is a dimer. 

    Ligand Summary





    1. (No Results)


      Discuss this publication
    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch