.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vp8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (NP_068944.1) from Archaeoglobus fulgidus at 1.30 A resolution. To be published
    Site JCSG
    PDB Id 1vp8 Target Id 356685
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS1364,NP_068944.1, 289438 Molecular Weight 20827.01 Da.
    Residues 189 Isoelectric Point 7.81
    Sequence mekkivyfnkpgrenteetlrlaverakelgikhlvvassygdtamkalemaeglevvvvtyhtgfvre gentmppeveeelrkrgakivrqshilsglersisrklggvsrteaiaealrslfghglkvcveitima adsgaipieevvavggrsrgadtavvirpahmnnffdaeikeiicmprnkr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.30 Rfree 0.16633
    Matthews' coefficent 2.78 Rfactor 0.15436
    Waters 156 Solvent Content 55.45

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vp8
    1. The Buccaneer software for automated model building. 1. Tracing protein chains
    K Cowtan - Acta Crystallographica Section D: Biological , 2006 - scripts.iucr.org
     
    2. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    3. Flavogenomicsa genomic and structural view of flavin_dependent proteins
    P Macheroux, B Kappes, SE Ealick - FEBS Journal, 2011 - Wiley Online Library
     
    4. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    5. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     

    Protein Summary

    The gene AF_0103 from Archaeoglobus fulgidus encodes the NP_068944 protein belonging to the PK-C group (PF 02887), containing a flavin binding domain. 

    SCOP classifies 1vp8 in the alpha/beta class, pyruvate kinase C-terminal domain like superfamily, MTH1675-like family. Its structure (1vp8) is similar to the protein MTH1675 from Methanobacterium thermoautotrophicum 1T57 (Dali Zscr=32; 50% seq. id.). A second Dali hit is with the pyruvate kinase 1e0t (Z=11). 

     

     

    [The MTH1020 adopts an N-terminal nucleophilic (NTN)-hydrolase fold type [Ref], which contains a four-layered a-b-b-a core structure.    NTN hydrolases superfamily of enzymes are characterised by a distinct fold and include a remarkable variety of hydrolytic activities. The superfamily includes the 20S proteasome, glutamine PRPP amidotransferases, glycosylasparaginases, penicillin acylase.  All known members catalyze the hydrolysis of amide bonds in either proteins or small molecules.]

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch