.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vp7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Exodeoxyribonuclease VII small subunit E.C.3.1.11.6 (NP_881400.1) from Bordetella pertussis at 2.40 A resolution. To be published
    Site JCSG
    PDB Id 1vp7 Target Id 356938
    Molecular Characteristics
    Source Bordetella pertussis tohama i
    Alias Ids TPS1371,NP_881400.1, 289772, 289775 Molecular Weight 9621.18 Da.
    Residues 88 Isoelectric Point 4.29
    Sequence masskqadpqtdarplpqdfetalaeleslvsamengtlpleqslsayrrgvelarvcqdrlaqaeqqv kvlegdllrpldpaaldde
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.2444
    Matthews' coefficent 3.75 Rfactor 0.20268
    Waters 133 Solvent Content 66.96

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vp7
    1. The Buccaneer software for automated model building. 1. Tracing protein chains
    K Cowtan - Acta Crystallographica Section D: Biological , 2006 - scripts.iucr.org
     
    2. Identification of two conserved aspartic acid residues required for DNA digestion by a novel thermophilic Exonuclease VII in Thermotoga maritima
    AA Larrea, IM Pedroso, A Malhotra - Nucleic acids , 2008 - Oxford Univ Press
     
    3. Delineation of structural domains and identification of functionally important residues in DNA repair enzyme exonuclease VII
    K Poleszak, KH Kaminska - Nucleic Acids , 2012 - Oxford Univ Press
     

    Protein Summary

    The gene NP_881400.1 from Bordetella pertussis encodes exonuclease VII small subunit PF02609 EC:3.1.11.6.  The protein is an all-alpha protein with spectrin repeat-like fold type SCOP46965.  The enzyme catalyzes the exonucleolytic cleavage in either 5'->3' or 3'->5' direction to yield nucleoside 5'-phosphates. This exonuclease VII enzyme is composed of one large subunit and 4 small ones.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch