.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vmk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Purine nucleoside phosphorylase (TM1596) from Thermotoga maritima at 2.01 A resolution. To be published
    Site JCSG
    PDB Id 1vmk Target Id 283453
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1302,TM1596, 282594 Molecular Weight 29171.52 Da.
    Residues 265 Isoelectric Point 6.67
    Sequence mmkkieeartfisertnlspdiliilgsgfgpfiekvedpviidykdiphfpqptveghsgklvfgris dkpvmimagrfhlyeghdpatvafpvylakyvgvkgvvvtnaagainpefkpgeiilvrdiinfmfrnp lrgpndekigprfpdmssvvdpewarkiqerlslkegvyigvlgpsyetpaeirvfeklgadlvgmstv peviaakhcglkvvvfscvtnmaagithgrlsheevvrttkmaqgkiekalttavevf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.01 Rfree 0.23995
    Matthews' coefficent 2.56 Rfactor 0.20391
    Waters 338 Solvent Content 51.64

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vmk
    1. PNP anticancer gene therapy
    Y Zhang, WB Parker, EJ Sorscher - Current topics in , 2005 - ingentaconnect.com
     
    2. Adenosine binding to low-molecular-weight purine nucleoside phosphorylase: the structural basis for recognition based on its complex with the enzyme from
    HM Pereira, MM Rezende, MS Castilho - Section D: Biological , 2009 - scripts.iucr.org
     
    3. Methylthioinosine phosphorylase from Pseudomonas aeruginosa. Structure and annotation of a novel enzyme in quorum sensing
    R Guan, MC Ho, SC Almo, VL Schramm - Biochemistry, 2011 - ACS Publications
     

    Protein Summary

    Purine nucleoside phosphorylase (TM1596) from Thermotoga maritima catalyzes the cleavage of guanosine or inosine to respective bases and sugar-1-phosphate molecules.

    There are several similar proteins with known structure, for example: 1c3xA, 1a9o, 1pf7E, 1tcuA, 1yqqA, 1g2oA, 2a8yA, 1v4nA, 1cb0A, and 1wtaA.

    TM1596 has phosphorylase/hydrolase-like fold (SCOP sunid 53162) core: 3 layers, ?/?/?; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch