.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vmg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of MazG nucleotide pyrophosphohydrolase (13816655) from Sulfolobus solfataricus at 1.46 A resolution. To be published
    Site JCSG
    PDB Id 1vmg Target Id 358109
    Molecular Characteristics
    Source Sulfolobus solfataricus p2
    Alias Ids TPS1384,13816655, 289702, 289427 Molecular Weight 9570.43 Da.
    Residues 83 Isoelectric Point 4.36
    Sequence mdlelkelqskmkemyfekdsqrgiyatftwlveevgelaeallsnnldsiqeeladviawtvsianle gidieealkkkykl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.46 Rfree 0.14633
    Matthews' coefficent 3.30 Rfactor 0.14178
    Waters 107 Solvent Content 62.40

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vmg
    1. The Buccaneer software for automated model building. 1. Tracing protein chains
    K Cowtan - Acta Crystallographica Section D: Biological , 2006 - scripts.iucr.org
     
    2. House cleaning, a part of good housekeeping
    MY Galperin, OV Moroz, KS Wilson - Molecular , 2006 - Wiley Online Library
     
    3. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    4. Dimeric dUTPases, HisE, and MazG belong to a New Superfamily of all-_ NTP Pyrophosphohydrolases with Potential House-cleaning Functions
    OV Moroz, AG Murzin, KS Makarova, EV Koonin - Journal of molecular , 2005 - Elsevier
     
    5. A putative house_cleaning enzyme encoded within an integron array: 1.8 crystal structure defines a new MazG subtype
    A Robinson, AP Guilfoyle, SJ Harrop - Molecular , 2007 - Wiley Online Library
     
    6. Crystal structure of RS21-C6, involved in nucleoside triphosphate pyrophosphohydrolysis
    B Wu, Y Liu, Q Zhao, S Liao, J Zhang, M Bartlam - Journal of molecular , 2007 - Elsevier
     
    7. Improvement of protein structure comparison using a structural alphabet
    AP Joseph, N Srinivasan, AG de Brevern - Biochimie, 2011 - Elsevier
     
    8. ACORN2: New developments of the ACORN concept
    EJ Dodson, MM Woolfson - Acta Crystallographica Section D: , 2009 - scripts.iucr.org
     
    9. The 1.25 A resolution structure of phosphoribosyl-ATP pyrophosphohydrolase from Mycobacterium tuberculosis
    F Javid-Majd, D Yang, TR Ioerger - Section D: Biological , 2008 - scripts.iucr.org
     
    10. Structure of a putative NTP pyrophosphohydrolase: YP_001813558. 1 from Exiguobacterium sibiricum 255-15
    GW Han, MA Elsliger, TO Yeates, Q Xu - Section F: Structural , 2010 - scripts.iucr.org
     
    11. Re-Annotation of Two Hyperthermophilic Archaea Pyrococcus abyssi GE5 and Pyrococcus furiosus DSM 3638
    J Gao, J Wang - Current microbiology, 2012 - Springer
     
    12. Structural and Functional Insights into DR2231 Protein, the MazG-like Nucleoside Triphosphate Pyrophosphohydrolase from Deinococcus radiodurans
    AMD Gonalves, D de Sanctis - Journal of Biological , 2011 - ASBMB
     
    13. Investigation of the structure and function of type III secretion needle and tip proteins
    L Zhang - 2009 - kuscholarworks.ku.edu
     

    Protein Summary

    The gene 13816655 from Sulfolobus solfataricus encodes a MazG nucleotide pyrophosphohydrolase domain PF03819.  The protein belongs to the class of all alpha proteins, and reveals all-alpha NTP pyrophosphatase fold type SCOP101385.  MazG proteins are highly conserved among bacteria and considered to be typical prokaryotic proteins.  The members of the MazG protein family are categorized by the homology to Escherichia coli MazG protein.  The complete structure of E.coli MazG have been solved 3CRA [Ref].  MazG is a nucleoside triphosphate pyrophosphohydrolase that hydrolyzes all canonical nucleoside triphosphates.  However, in the case of MazG from Thermotoga maritima, the enzyme has both nucleoside triphosphate pyrophosphohydrolase and pyrophosphatase activities [Ref].  On a cellular level, the MazG function is the regulation of bacterial cell survival under nutritional stress.

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    2. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch