.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vmf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (10176122) from Bacillus halodurans at 1.46 A resolution. To be published
    Site JCSG
    PDB Id 1vmf Target Id 356786
    Molecular Characteristics
    Source Bacillus halodurans c-125
    Alias Ids TPS1368,10176122, 289321 Molecular Weight 15081.28 Da.
    Residues 133 Isoelectric Point 5.75
    Sequence mktfhlttqsrdemvditsqietwiretgvtngvaivsslhttagitvnenadpdvkrdmimrldevyp whhendrhmegntaahlktstvghaqtliisegrlvlgtwqgvyfcefdgprtnrkfvvklltd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.46 Rfree 0.17483
    Matthews' coefficent 2.31 Rfactor 0.14832
    Waters 419 Solvent Content 46.64

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vmf
    1. The Buccaneer software for automated model building. 1. Tracing protein chains
    K Cowtan - Acta Crystallographica Section D: Biological , 2006 - scripts.iucr.org
     
    2. On the combination of molecular replacement and single-wavelength anomalous diffraction phasing for automated structure determination
    S Panjikar, V Parthasarathy, VS Lamzin - Section D: Biological , 2009 - scripts.iucr.org
     
    3. Sensitive genome-wide screen for low secondary enzymatic activities: the YjbQ family shows thiamin phosphate synthase activity
    E Morett, G Saab-Rincn, L Olvera, M Olvera - Journal of molecular , 2008 - Elsevier
     
    4. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    5. Crystal structure of the hypothetical protein ST2072 from Sulfolobus tokodaii
    Y Tanaka, K Tsumoto, E Tanabe - Proteins: Structure, , 2005 - Wiley Online Library
     

    Protein Summary

    The gene BH3498 from Bacillus halodurans encodes the NP_244365 protein from the uncharacterized protein family UPF0047 (PF01894). 

    The 1vmf structure belongs to the class of alpha and beta proteins (a+b), and reveals a YjbQ-like fold type SCOP111037.  This protein family is rather conserved among different bacteria species, and multiple structures of homologuous proteins from this family have been solved.  For instance, the crystal structure of B.subtilis ortholog yugU has been solved 1VMH (Dali Z=23); the structure of homologuous Q97KL0 from Clostridium acetobutylicum has been reported 1XBF (Z=23); and the TM0723  homolog 1vmj (Z=20).  

    Importantly, the YjbQ gene product from E.coli exhibits thiamin phosphate synthase activity in vitro [Ref].  Thus, the UPF0047 group may represent this class of enzymes.

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch