The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of 30S ribosomal protein S6 (TM0603) from Thermotoga maritima at 1.70 A resolution. To be published
    Site JCSG
    PDB Id 1vmb Target Id 282476
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1219,TM0603, 89397 Molecular Weight 15368.73 Da.
    Residues 128 Isoelectric Point 5.81
    Sequence mayvkeriyesmfiiapnvpeeerenlvervkkiieervkgkidkvermgmrkfayeikkfnegdytvi yfrcdgqnlqelenfyrvtpeiirwqtfrrfdlekkerkaqrekaaaeatesseggsed
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.23735
    Matthews' coefficent 2.37 Rfactor 0.18287
    Waters 116 Solvent Content 47.67

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information


    Google Scholar output for 1vmb
    1. The JCSG MR pipeline: optimized alignments, multiple models and parallel searches
    R Schwarzenbacher, A Godzik - Section D: Biological , 2007 - scripts.iucr.org
    2. Crystal structure of the DUF54 family protein PH1010 from hyperthermophilic archaea Pyrococcus horikoshii OT3
    K Miyazono, M Shirokane, Y Sawano - Proteins: Structure, , 2009 - Wiley Online Library

    Protein Summary

    The TM0603 from Thermotoga maritima encodes the 30S ribosomal protein S6 (PF01250, COG0360). The TM0603 structure adopts a ferredoxin-like fold  and shows significant similarity (main-chain rmsd of 1.4 Å over 95 residues with a sequence identity of 21%) with the 30S ribosomal protein S6 from another hyperthermophile, Thermus thermophilus (PDB ids: 1hnw, 1hnz, 1j53, 2hhh, 2uub, 3f1g). Similar results were obtained for homologs from Staphylococcus epidermis (PDB id: 3fle) and Escherichia coli (PDB ids: 1g1x, 2gy9). For more details on the assembly, structure and functions of the 30S ribosomal subunit see Agalarov 2000, Brodersen 2000, Brodersen 2002 and Korostelev 2008.

    Ligand Summary





    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch