.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vm7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Ribokinase (TM0960) from Thermotoga maritima at 2.15 A resolution. To be published
    Site JCSG
    PDB Id 1vm7 Target Id 282829
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1249,TM0960, 3.40.1190.20, 84675 Molecular Weight 32652.69 Da.
    Residues 299 Isoelectric Point 4.96
    Sequence mflvisvvgssnidivlkvdhftkpgetqkaiemnvfpggkganqavtvakigekgcrfvtcignddys dllienyeklgitgyirvslptgrafievdktgqnriiifpganaelkkelidwntlsesdilllqnei pfettlecakrfngivifdpapaqgineeifqyldyltpnekeiealskdffgefltvekaaekflelg vknvivklgdkgvllvnknekkhfptfkvkavdttaagdvfngafavalsegknpeeavifgtaaaais vtrlgaqssipareeveaflknl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.15 Rfree 0.23539
    Matthews' coefficent 2.34 Rfactor 0.18954
    Waters 279 Solvent Content 47.13

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vm7
    1. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    2. Overexpression, purification and crystallographic analysis of a unique adenosine kinase from Mycobacterium tuberculosis
    Y Wang, MC Long, S Ranganathan - Section F: Structural , 2005 - scripts.iucr.org
     
    3. Structure of Methanocaldococcus jannaschii nucleoside kinase: an archaeal member of the ribokinase family
    L Arnfors, T Hansen, P Schonheit - Section D: Biological , 2006 - scripts.iucr.org
     

    Protein Summary

    The gene TM0960 from Thermotoga maritima encodes ribokinase from pfkB-like superfamily of carbohydrate kinases PF00294 COG0524.  Ribokinase catalyses the phosphorylation of ribose to ribose-5-phosphate using ATP. This reaction is the first step in the metabolism of ribose.  Ribokinase traps ribose within the cell after uptake and also prepares the sugar for use in the synthesis of nucleotides and histidine, and for entry into the pentose phosphate pathway. This family also includes a variety of carbohydrate and pyrimidine kinases.  This enzyme is a part of the thiamine pyrophosphate (TPP) synthesis pathway. TPP is an essential cofactor for many enzymes [Ref] .  Ribokinase is dimeric in solution.

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch