.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vly

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Unknown protein from 2D-page (Spot PR51) (b2898) from Escherichia coli k12 at 1.30 A resolution. To be published
    Site JCSG
    PDB Id 1vly Target Id 358289
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS1386,NP_417374.1 Molecular Weight 36092.16 Da.
    Residues 326 Isoelectric Point 5.18
    Sequence maftpfpprqptasarlpltlmtlddwalatitgadsekymqgqvtadvsqmaedqhllaahcdakgkm wsnlrlfrdgdgfawierrsvrepqltelkkyavfskvtiapddervllgvagfqaraalanlfselps kekqvvkegattllwfehpaerflivtdeatanmltdklrgeaelnnsqqwlalnieagfpvidaansg qfipqatnlqalggisfkkgcytgqemvarakfrgankralwllagsasrlpeagedlelkmgenwrrt gtvlaavkledgqvvvqvvmnndmepdsifrvrddantlhieplpyslee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.30 Rfree 0.16785
    Matthews' coefficent 2.10 Rfactor 0.13402
    Waters 477 Solvent Content 41.11

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vly
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    3. ACORN2: New developments of the ACORN concept
    EJ Dodson, MM Woolfson - Acta Crystallographica Section D: , 2009 - scripts.iucr.org
     

    Protein Summary

    The gene ygfZ from Escherichia coli k12 encodes the NP_417374 protein, with sequence similarity to the aminomethyltransferase folate binding domain (PF01571).  

    The 1vly structure displays two domains: the N-terminal (1-242) belongs to the class of alpha and beta proteins (a+b) and reveals a folate binding domain fold SCOP103024 (SUNID:103026), inside the folate binding domain superfamily, aminomethyltransferase folate-binbding domain fmaily; the C-terminal region (244-325) belongs to the aminomethyltransferase beta-barrel domain (super)family.  According to DALI, 1vly structural neighbors are aminomethyltransferases like PDB:1yx2 (Z=28), PDB:1woo (Z=27), PDB:1wsv (Z=26), PDB:1vlo (Z=25).

     

    1NRK PDB entry corresponds to an identical structure, discussed in [Ref].

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch