.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vlj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of NADH-dependent butanol dehydrogenase A (TM0820) from Thermotoga maritima at 1.78 A resolution. To be published
    Site JCSG
    PDB Id 1vlj Target Id 282690
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1238,TM0820, _0056.000797_, 89311 Molecular Weight 43352.81 Da.
    Residues 395 Isoelectric Point 6.70
    Sequence menfvfhnptkivfgrgtipkigeeiknagirkvlflygggsikkngvydqvvdslkkhgiewvevsgv kpnpvlskvheavevakkekveavlgvgggsvvdsakavaagalyegdiwdafigkyqiekalpifdvl tisatgtemngnavitnektkekygvsskalypkvsiidpsvqftlpkeqtvygavdaishileyyfdg sspeisneiaegtirtimkmterliekpddyearanlawsatialngtmavgrrggewachriehslsa lydiahgaglaivfpawmkyvyrknpaqferfakkifgfegegeelilkgieafknwlkkvgapvslkd agipeedidkivdnvmllveknlkpkgaslgrimvleredvreilklaak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.78 Rfree 0.19265
    Matthews' coefficent 2.00 Rfactor 0.14224
    Waters 480 Solvent Content 38.08

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vlj
    1. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    2. The JCSG MR pipeline: optimized alignments, multiple models and parallel searches
    R Schwarzenbacher, A Godzik - Section D: Biological , 2007 - scripts.iucr.org
     
    3. 1, 3-propanediol dehydrogenase from Klebsiella pneumoniae: decameric quaternary structure and possible subunit cooperativity
    D Maral, AT Rgo, MA Carrondo - Journal of , 2009 - Am Soc Microbiol
     
    4. Shotgun crystallization strategy for structural genomics II: crystallization conditions that produce high resolution structures for T. maritima proteins
    R Page, AM Deacon, SA Lesley - Journal of structural and , 2005 - Springer
     

    Protein Summary


    The gene TM0820 from Thermotoga maritima encodes NADH-dependent butanol dehydrogenase A, which is a member of iron containing alcohol dehydrogenases. It is dimeric and comprises a Rossmann fold NAD binding domain and an all alpha domain, similar to several other oxidoreductases in the pdb. Both domains are involved in dimerization. The enzyme is highly homologous to NADH-dependent butanol dehydrogenase A from Sulfurihydrogenibium azorense PF00465 COG1979.  The enzyme catalyzes the reversible oxidation of butanol to butanaldehyde with the concomitant reduction of NAD E.C.1.1.1.2.  The NADH-dependent butanol dehydrogenases bdhA and bdhB from Clostridium acetobutylicum can use both ethanol and butanol as substrates  [Ref].

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch