.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vla

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Hydroperoxide resistance protein OsmC (TM0919) from Thermotoga maritima at 1.80 A resolution. To be published
    Site JCSG
    PDB Id 1vla Target Id 282788
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1245,TM0919, 84874 Molecular Weight 16002.84 Da.
    Residues 138 Isoelectric Point 6.43
    Sequence mqarwignmmfhvrtdsnhdvlmdtkeevggkdaaprplelvltglmgctgmdvvsilrkmkvidqmkd frieieyerteehpriftkvhlkyifkfdgeppkdkvekavqlsqekycsvsailkcsskvtyeivyen
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.2213
    Matthews' coefficent 2.03 Rfactor 0.17034
    Waters 464 Solvent Content 38.89

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vla
    1. Domain definition and target classification for CASP6
    M Tress, CH Tai, G Wang, I Ezkurdia - PROTEINS: , 2005 - Wiley Online Library
     
    2. Fast and accurate algorithms for protein side-chain packing
    J Xu, B Berger - Journal of the ACM (JACM), 2006 - dl.acm.org
     
    3. Refining homology models by combining replica_exchange molecular dynamics and statistical potentials
    J Zhu, H Fan, X Periole, B Honig - : Structure, Function, and , 2008 - Wiley Online Library
     
    4. The JCSG MR pipeline: optimized alignments, multiple models and parallel searches
    R Schwarzenbacher, A Godzik - Section D: Biological , 2007 - scripts.iucr.org
     
    5. Prediction of 3D metal binding sites from translated gene sequences based on remote_homology templates
    R Levy, M Edelman, V Sobolev - Proteins: Structure, Function, , 2009 - Wiley Online Library
     
    6. Prediction of protein domain boundaries from statistics of appearance of amino acid residues
    OV Galzitskaya, NV Dovidchenko, MY Lobanov - Molecular Biology, 2006 - Springer
     
    7. Antibodies as a model system for comparative model refinement
    BD Sellers, JP Nilmeier - : Structure, Function, and , 2010 - Wiley Online Library
     
    8. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    9. Investigating diproline segments in proteins: Occurrences, conformation and classification
    I Saha, N Shamala - Biopolymers, 2012 - Wiley Online Library
     
    10. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     

    Protein Summary

    Thermotoga maritima protein TM0919  belongs to the large family of OsmC-like proteins (PF02566, COG1765, and COG1764). Proteins from this family are present mostly in bacteria, but also in protists, slime molds and fungi and are involved in oxidative / osmotic stress response and hydroperoxide detoxification. Interestingly, eukaryotic proteins from this family do not form a common sub-tree and appear to represents independent gene transfer events.

    Other proteins from this family solved by JCSG are
    protein Psyc_0566 from Psychrobacter arcticus(2pn2) and Thermoplasma acidiophilumprotein NP_393673.1 (2onf).  Structurally, 1vla and its homologs (PDB structures 2onf, 1ml8, 2d7v, 1n2f, 1qwi, and 2opl) belong to the OsmC-like fold from alpha+beta class.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch