.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vl1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of 6-phosphogluconolactonase (TM1154) from Thermotoga maritima at 1.70 A resolution. To be published
    Site JCSG
    PDB Id 1vl1 Target Id 283020
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1265,TM1154, _0112.001592_, 282356, 90079 Molecular Weight 25323.86 Da.
    Residues 220 Isoelectric Point 6.35
    Sequence mektviylledgyvdfvvekirtkmeklleekdkifvvlaggrtplpvyeklaeqkfpwnrihfflsde ryvpldsdqsnfrninevlfsrakipsgnvhyvdtslpiekacekyereirsatdqfdlailgmgpdgh vasifdletgnkdnlvtftdpsgdpkvprvtltfralntslyvlflirgkekinrlteilkdtplpayf vrgkektvwfvgk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.55 Rfree 0.20395
    Matthews' coefficent 1.93 Rfactor 0.16523
    Waters 167 Solvent Content 35.71

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vl1
    1. Hydrogen_bonded turns in proteins: The case for a recount
    N Panasik Jr, PJ Fleming, GD Rose - Protein science, 2005 - Wiley Online Library
     
    2. De-orphaning the structural proteome through reciprocal comparison of evolutionarily important structural features
    RM Ward, S Erdin, TA Tran, DM Kristensen - PloS one, 2008 - dx.plos.org
     
    3. Three Dimensional Structure and Implications for the Catalytic Mechanism of 6-Phosphogluconolactonase from Trypanosoma brucei
    M Delarue, N Duclert-Savatier, E Miclet - Journal of molecular , 2007 - Elsevier
     
    4. Crystal structures of the effector_binding domain of repressor Central glycolytic gene Regulator from Bacillus subtilis reveal ligand_induced structural changes upon
    P _ez_ov, M Koek, SF Moy - Molecular , 2008 - Wiley Online Library
     
    5. Autoindexing with outlier rejection and identification of superimposed lattices
    NK Sauter, BK Poon - Journal of Applied Crystallography, 2010 - scripts.iucr.org
     
    6. Insights into the enzymatic mechanism of 6-phosphogluconolactonase from Trypanosoma brucei using structural data and molecular dynamics simulation
    N Duclert-Savatier, L Poggi, E Miclet, P Lopes - Journal of molecular , 2009 - Elsevier
     
    7. Expression, crystallization and preliminary X-ray crystallographic analysis of Xoo2316, a predicted 6-phosphogluconolactonase, from Xanthomonas oryzae pv. oryzae
    MK Hong, JK Kim, H Kim, J Jung, YJ Ahn - Section F: Structural , 2008 - scripts.iucr.org
     

    Protein Summary

    The gene TM1154 from Thermotoga maritima encodes 6-phosphogluconolactonase, member of sugar phosphate isomerase family, oxydoreductase PF01182 COG0363.  The structure of this protein has been previously solved 1PBT. 6-phosphogluconolactonase is the enzyme responsible for the hydrolysis of 6-phosphogluconolactone to 6-phosphogluconate, the second step of the oxidative phase of the pentose phosphate pathway.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch