.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vky

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of S-adenosylmethionine:tRNA ribosyltransferase-isomerase (QueA) from Thermotoga maritima at 2.0 A resolution reveals a new fold. Proteins 59 869-874 2005
    Site JCSG
    PDB Id 1vky Target Id 282447
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1217,TM0574, 84935 Molecular Weight 38660.09 Da.
    Residues 335 Isoelectric Point 8.61
    Sequence mkvsefdyelppeliaqepveprdasrlmvlhrktqriehrifreiieylepgdllvlnvskviparly arkktgasieillierleegiwkclvrpgqkvkkgtelvidedlsavclgrgedgtrilkfqpqddrli fekgrtplppyiknevpleryqtvyakeegsvaaptaglhftpelieklkkkgvqfaevvlhvgigtfr pvkveevekhkmheefyqvpketvrklretrergnrivavgtttvrtletiarlpeqeeyvgktdlfiy ppfefklvdalvtnfhlprstllmlvaafagkdfvmeayreavkrryrffsfgdamlil
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.21041
    Matthews' coefficent 2.98 Rfactor 0.17951
    Waters 162 Solvent Content 58.78

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vky
    1. The Buccaneer software for automated model building. 1. Tracing protein chains
    K Cowtan - Acta Crystallographica Section D: Biological , 2006 - scripts.iucr.org
     
    2. Natural history of S-adenosylmethionine-binding proteins
    PZ Kozbial, AR Mushegian - BMC structural biology, 2005 - w09.biomedcentral.com
     
    3. Small but versatile: the extraordinary functional and structural diversity of the beta-grasp fold
    AM Burroughs, S Balaji, LM Iyer, L Aravind - Biol Direct, 2007 - biomedcentral.com
     
    4. Microbial biochemistry, physiology, and biotechnology of hyperthermophilic Thermotoga species
    SB Conners, EF Mongodin, MR Johnson - FEMS microbiology , 2006 - Wiley Online Library
     
    5. Domain definition and target classification for CASP6
    M Tress, CH Tai, G Wang, I Ezkurdia - PROTEINS: , 2005 - Wiley Online Library
     
    6. Cradle-loop barrels and the concept of metafolds in protein classification by natural descent
    V Alva, KK Koretke, M Coles, AN Lupas - Current opinion in structural , 2008 - Elsevier
     
    7. Molecular structure and metal-binding properties of the periplasmic CopK protein expressed in Cupriavidus metallidurans CH34 during copper challenge
    B Bersch, A Favier, P Schanda, S Van Aelst - Journal of molecular , 2008 - Elsevier
     
    8. Autoindexing with outlier rejection and identification of superimposed lattices
    NK Sauter, BK Poon - Journal of Applied Crystallography, 2010 - scripts.iucr.org
     
    9. Crystal structure of S_adenosylmethionine: tRNA ribosyltransferase_isomerase (QueA) from Thermotoga maritima at 2.0 resolution reveals a new fold
    I Mathews, R Schwarzenbacher - Proteins: Structure, , 2005 - Wiley Online Library
     
    10. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    11. Direct evidence for CH___ _ interaction mediated stabilization of Pro-cisPro bond in peptides with Pro-Pro-Aromatic motifs
    HK Ganguly, B Majumder - Journal of the , 2012 - ACS Publications
     
    12. Search for identical octapeptides in unrelated proteins: Structural plasticity revisited
    KM Saravanan, S Selvaraj - Peptide Science, 2012 - Wiley Online Library
     
    13. Structural and Functional Studies of tRNA-Guanine Transglycosylase: A putative Drug Target for Shigellosis Therapy
    B Stengl - 2006 - archiv.ub.uni-marburg.de
     
    14. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     
    15. Carbohydrate utilization pathway analysis in the hyperthermophile Thermotoga maritima
    SB Conners - 2006 - repository.lib.ncsu.edu
     

    Protein Summary

    The TM0574 gene of Thermotoga maritima encodes an S-adenosylmethionine:tRNA ribosyltransferase-isomerase (QueA; Pfam02547). The structure is made of a large alpha/beta/alpha domain with a small inserted beta-barrel domain. This structure defines the novel QueA-like fold (SCOP sunid:111336).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch