.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vkf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Glycerol uptake operon antiterminator-related protein (TM1436) from Thermotoga maritima at 1.65 A resolution. To be published
    Site JCSG
    PDB Id 1vkf Target Id 283296
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1287,TM1436, 282355 Molecular Weight 19295.77 Da.
    Residues 176 Isoelectric Point 7.89
    Sequence mfkgiiaalwdmdsigeiepdvvfllksdilnlkfhlkilkdrgktvfvdmdfvnglgegeeailfvkk agadgiitikpknyvvakkngipavlrffaldskavergieqietlgvdvvevlpgavapkvarkipgr tviaaglveteeeareilkhvsaistssrilwkmkflp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.65 Rfree 0.21126
    Matthews' coefficent 2.94 Rfactor 0.18517
    Waters 391 Solvent Content 57.88

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vkf
    1. High-throughput protein production for X-ray crystallography and use of size exclusion chromatography to validate or refute computational biological unit predictions
    D McMullan, JM Canaves, K Quijano - Journal of structural and , 2005 - Springer
     
    2. Functional differentiation of proteins: implications for structural genomics
    I Friedberg, A Godzik - Structure, 2007 - Elsevier
     

    Protein Summary

    The gene TM1436 from Thermotoga maritima encodes glycerol uptake antiterminator protein regulon (mRNA binding) PF04309  COG1954.  A search for structurally similar proteins with DALI provides hits with the antiterminator protein regulon 3kts (Z=24), and the orotidine monophospahate decarboxylase 1los (Z=15).

    One of the closest homologues is B. subtilis glpP [Ref][Ref].  The main function of the protein is to enhance the transcription in the presence of glycerol 3-phosphate.  Antitermination of transcription mediated by proteins interacting with mRNA sequences is described for nine operons/regulons. Eight of the systems are catabolic, while the ninth, the Klebsiella pneumoniae nas regulon, is involved in the assimilation of nitrate and nitrite. The antiterminator protein of the B. subtilis glpP regulon has been found not only to cause antitermination but also to stabilize the resultant mRNA and to mediate glucose repression [Ref].  In B. subtilis,  glpP regulates the expression of glpFK, glpD and glpTQ genes.

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    2. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch