.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vjg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative lipase from the G-D-S-L family from Nostoc sp. at 2.01 A resolution. To be published
    Site JCSG
    PDB Id 1vjg Target Id 354318
    Related PDB Ids 1z8h 
    Molecular Characteristics
    Source Nostoc sp. pcc 7120
    Alias Ids TPS1915,17135349 Molecular Weight 23594.68 Da.
    Residues 206 Isoelectric Point 8.30
    Sequence mtkqsktqiricfvgdsfvngtgdpeclgwtgrvcvnankkgydvtyynlgirrdtssdiakrwlqevs lrlhkeynslvvfsfglndttlengkprvsiaetikntreiltqakklypvlmispapyieqqdpgrrr rtidlsqqlalvcqdldvpyldvfpllekpsvwlheakandgvhpqaggytefarivenwdawlnwfr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.01 Rfree 0.21832
    Matthews' coefficent 2.43 Rfactor 0.17247
    Waters 93 Solvent Content 48.97

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1vjg
    1. Three-stage prediction of protein _-sheets by neural networks, alignments and graph algorithms
    J Cheng, P Baldi - Bioinformatics, 2005 - Oxford Univ Press
     
    2. Crystal structure of a full-length autotransporter
    B Van Den Berg - Journal of molecular biology, 2010 - Elsevier
     
    3. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    4. Structure of a novel enzyme that catalyzes acyl transfer to alcohols in aqueous conditions
    I Mathews, M Soltis, M Saldajeno, G Ganshaw - Biochemistry, 2007 - ACS Publications
     
    5. Crystal Structure of a Cellulosomal Family 3 Carbohydrate Esterase from Clostridium thermocellum Provides Insights into the Mechanism of Substrate
    MAS Correia, JAM Prates, J Brs, CMGA Fontes - Journal of molecular , 2008 - Elsevier
     
    6. Uncharacterized DUF1574 leptospira proteins are SGNH hydrolases
    L Knizewski, K Steczkiewicz, K Kuchta - CELL CYCLE- , 2008 - landesbioscience.com
     
    7. Biochemical characterization of Alr1529, a novel SGNH hydrolase variant from Anabaena sp. PCC 7120
    K Bakshy, SN Gummadi, N Manoj - et Biophysica Acta (BBA)-Proteins & , 2009 - Elsevier
     
    8. The structure at 1.6 A resolution of the protein product of the At4g34215 gene from Arabidopsis thaliana
    E Bitto, CA Bingman, JG McCoy, STM Allard - Section D: Biological , 2005 - scripts.iucr.org
     
    9. YesT: A new rhamnogalacturonan acetyl esterase from Bacillus subtilis
    I Martnez_Martnez - Proteins: Structure, , 2008 - Wiley Online Library
     
    10. Characterization, amyloid formation, and immobilization of a novel SGNH hydrolase from Listeria innocua 11262
    S Kim, SY Bae, SJ Kim, TD Ngo, KK Kim - International Journal of , 2011 - Elsevier
     
    11. Machine learning algorithms for protein structure prediction
    J Cheng - 2006 - Citeseer
     
    12. Orphanet Journal of Rare Diseases
    EA Colombo, FJ Bazan, G Negri, C Gervasini - Orphanet Journal of , 2012 - ojrd.com
     
    13. MS93. P08
    DT Nair, N Sivakumara, D Jaina - Foundations of , 2011 - scripts.iucr.org
     
    14. Structural and functional insights into the role of Carbohydrate Esterases and Carbohydrate-Binding Modules in plant cell wall hydrolysis
    MAS Correia - 2009 - repository.utl.pt
     

    Protein Summary

    The alr1529 gene from Nostoc sp. PCC 7120 encodes for a GDSL-like lipase. JCSG has refined this protein structure in two crystal forms, this entry describes space group P 32 2 1,  the second entry, 1z8h, describes space group P 21 21 21 and contains an unknown intermediate near the active site. We refer the reader to this entry for more information.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    1z8h.png
    No description
    47.75 kB19:20, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch