The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Solution structures of the putative anti-sigma-factor antagonist TM1442 from Thermotoga maritima in the free and phosphorylated states. Magn.Reson.Chem. 44 Spec No S61-S70 2006
    Site JCSG
    PDB Id 1t6r Target Id 283301
    Related PDB Ids 1sbo 
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1913,TM1442 Molecular Weight 12299.53 Da.
    Residues 110 Isoelectric Point 5.81
    Sequence mnnlkldiveqddkaivrvqgdidaynsselkeqlrnfisttskkkivldlssvsymdsaglgtlvvil kdakingkefilsslkesisrilklthldkifkitdtveea
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information


    Google Scholar output for 1t6r
    1. Microbial biochemistry, physiology, and biotechnology of hyperthermophilic Thermotoga species
    SB Conners, EF Mongodin, MR Johnson - FEMS microbiology , 2006 - Wiley Online Library
    2. Solution structures of the putative anti___factor antagonist TM1442 from Thermotoga maritima in the free and phosphorylated states
    T Etezady_Esfarjani, WJ Placzek - Magnetic , 2006 - Wiley Online Library
    3. Carbohydrate utilization pathway analysis in the hyperthermophile Thermotoga maritima
    SB Conners - 2006 - repository.lib.ncsu.edu
    4. On the contribution of linear correlations to quasi-harmonic conformational entropy in proteins
    AA Polyansky, A Kuzmanic, M Hlevnjak - Journal of Chemical , 2012 - ACS Publications
    5. Protein structure prediction and conformational transitions
    H Cheng - 2009 - lib.dr.iastate.edu

    Protein Summary

    The gene TM1442 from Thermotoga maritima encodes the NP_229241 protein, an anti-sigma factor antagonist domain of anti-anti-sigma factors (the STAS domain) PF01740 COG1366.  

    SCOP classifies 1t6r in the alpha/beta class, SpoIIAA-like superfamily, anti-sigma factor antagonist family. 1t6r entry corresponds to the solution structure of TM1441 in the phosphorylated state [Ref]. Its crystal structure is available as PDB:1vc1. Significant DALI hits are found with anti-sigma F factor proteins PDB:1thn, PDB:1til, PDB:1tid (Z=16), and the TM1081 proteins PDB:3f43 and PDB:2ka5 (Z=15).

    Anti-anti-sigma factors play an important role in the regulation of several sigma factors and their corresponding anti-sigma factors. Upon dephosphorylation they bind the anti-sigma factor and induce the release of the sigma factor from the anti-sigma factor. In a feedback mechanism the anti-anti-sigma factor can be inactivated via phosphorylation by the anti-sigma factor. Well studied examples from Bacillus subtilis are SpoIIAA (regulating sigmaF and sigmaC which play an important role in sporulation) and RsbV (regulating sigmaB involved in the general stress response) [Ref]. The STAS domain is also found in the C-terminal region of sulphate transporters and stressosomes.

    Ligand Summary





    1. (No Results)


      Discuss this publication
    2. (No Results)


      Discuss this publication
    Tag page

    Files (2)

    FileSizeDateAttached by 
    No description
    48.48 kB20:09, 30 Jun 2008dweekesActions
    No description
    18.57 kB20:09, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch