.
The Open Protein Structure Annotation Network
PDB Keyword
.

1r73

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title NMR for structural proteomics of Thermotoga maritima: Screening and structure determination. J.STRUCT.FUNCT.GENOM. 5 205-215 2004
    Site JCSG
    PDB Id 1r73 Target Id 283349
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1293,TM1492, 89424, 84796 Molecular Weight 7972.04 Da.
    Residues 66 Isoelectric Point 10.27
    Sequence mkaselrnytdeelknlleekkrqlmelrfqlamgqlkntslikltkrdiariktilrerelgirr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1r73
    1. NMR for structural proteomics of Thermotoga maritima: screening and structure determination
    W Peti, T Etezady-Esfarjani, T Herrmann - Journal of structural and , 2004 - Springer
     
    2. Protein structural classification and family identification by multifractal analysis and wavelet spectrum
    SM Zhu, ZG Yu, A Vo - Chinese Physics B, 2011 - iopscience.iop.org
     
    3. Exploring protein structural dissimilarity to facilitate structure classification
    P Jain, J Hirst - BMC structural biology, 2009 - biomedcentral.com
     

    Protein Summary

    The gene TM1492 from Thermotoga maritima encodes 50S ribosomal protein L29 PF00831 COG0255, a superfamily of ribosomal L29 protein/HIP proteins.  As expected, theses proteins are well-conserved among different bacteria species.  L29 is a protein of the large ribosomal subunit. A homolog, called heparin/heparan sulfate interacting protein (HIP), has also been identified in mammals. L29 is located on the surface of the large ribosomal subunit, where it participates in forming a protein ring that surrounds the polypeptide exit channel, providing structural support for the ribosome. L29 is involved in forming the translocon binding site, along with L19, L22, L23, L24, and L31e. In addition, L29 and L23 form the interaction site for trigger factor (TF) on the ribosomal surface, adjacent to the exit tunnel. L29 forms numerous interactions with L23 and with the 23S rRNA. In some eukaryotes, L29 is referred to as L35, which is distinct from L35 found in bacteria and some eukaryotes (primarily plastids and mitochondria). The mammalian homolog, HIP, is found on the surface of many tissues and cell lines. It is believed to play a role in cell adhesion and modulation of blood coagulation [Ref]. It has also been shown to inhibit apoptosis in cancer cells [Ref].  Interestingly, in human lungs and small intestines, HIP acts as a major broad-spectrum antimicrobial protein [Ref].

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    2. (No Results)

       


      Discuss this publication
    3. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch