.
The Open Protein Structure Annotation Network
PDB Keyword
.

1o6a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of the C-terminal fragment of the putative flagellar motor switch protein FliN (TM0680a) from Thermotoga maritima at 1.85 A resolution. To be published
    Site JCSG
    PDB Id 1o6a Target Id 356088
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1355,TM0680 Molecular Weight 17302.83 Da.
    Residues 162 Isoelectric Point 4.16
    Sequence mteneflsqeeidkllsdsdtggvltpeekdmigeigniamgsaattlsmilgrdihitvptvreekmk nvksdfsgeqvvvsveytegleglnvlvldkklvaviadlmmggsgeveteeldeiklsavgeamnqmm gsaatslsellgitinisppkvei
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.21199
    Matthews' coefficent 2.50 Rfactor 0.17102
    Waters 150 Solvent Content 50.33

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1o6a
    1. The Buccaneer software for automated model building. 1. Tracing protein chains
    K Cowtan - Acta Crystallographica Section D: Biological , 2006 - scripts.iucr.org
     
    2. Conserved features of type III secretion
    AP Tampakaki, VE Fadouloglou, AD Gazi - Cellular , 2004 - Wiley Online Library
     
    3. Crystal structure of the flagellar rotor protein FliN from Thermotoga maritima
    PN Brown, MAA Mathews, LA Joss, CP Hill - Journal of , 2005 - Am Soc Microbiol
     
    4. Structure and function of an unusual family of protein phosphatases: the bacterial chemotaxis proteins CheC and CheX
    SY Park, X Chao, G Gonzalez-Bonet, BD Beel - Molecular cell, 2004 - Elsevier
     
    5. Structural and functional studies of the enteropathogenic Escherichia coli type III needle complex protein EscJ
    VF Crepin, S Prasannan, RK Shaw - Molecular , 2005 - Wiley Online Library
     
    6. Organization of FliN subunits in the flagellar motor of Escherichia coli
    K Paul, DF Blair - Journal of bacteriology, 2006 - Am Soc Microbiol
     
    7. Mutational analysis of the flagellar rotor protein FliN: identification of surfaces important for flagellar assembly and switching
    K Paul, JG Harmon, DF Blair - Journal of bacteriology, 2006 - Am Soc Microbiol
     
    8. Bacterial nanomachines: the flagellum and type III injectisome
    M Erhardt, K Namba, KT Hughes - Cold Spring Harbor , 2010 - cshperspectives.net
     
    9. Shotgun crystallization strategy for structural genomics II: crystallization conditions that produce high resolution structures for T. maritima proteins
    R Page, AM Deacon, SA Lesley - Journal of structural and , 2005 - Springer
     
    10. On the quaternary association of the type III secretion system HrcQB-C protein: Experimental evidence differentiates among the various oligomerization models
    VE Fadouloglou, MN Bastaki, AE Ashcroft - Journal of structural , 2009 - Elsevier
     
    11. Single-Molecule Studies of Rotary Molecular Motors
    T Pilizota, Y Sowa, RM Berry - Handbook of Single-Molecule Biophysics, 2009 - Springer
     
    12. Molecular Assembly in Natural and Engineered Systems
    S Howorka - 2011 - books.google.com
     

    Protein Summary

    The gene TM0680 from Thermotoga maritima encodes the C-terminal domain of the flagellar motor switch protein FliY (PF07859).  The complete FliY protein possesses phosphatase activity [Ref].  Structurally, it can be related to CheC protein from the same organism 1XKR SCOP103038 PF04509.  The protein belongs to a group of factors controlling bacterial chemotaxis.

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch