.
The Open Protein Structure Annotation Network
PDB Keyword
.

1o54

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of SAM-dependent O-methyltransferase (TM0748) from Thermotoga maritima at 1.65 A resolution. To be published
    Site JCSG
    PDB Id 1o54 Target Id 282618
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1230,TM0748, 85016 Molecular Weight 30105.25 Da.
    Residues 265 Isoelectric Point 5.66
    Sequence mgkvadtlkpgdrvllsfedeseflvdlekdkklhthlgiidlnevfekgpgeiirtsagkkgyilips lideimnmkrrtqivypkdssfiammldvkegdriidtgvgsgamcavlaravgssgkvfayekreefa klaesnltkwgliervtikvrdisegfdekdvdalfldvpdpwnyidkcwealkgggrfatvcpttnqv qetlkklqelpfirievweslfrpykpvperlrpvdrmvahtaymifatkvcrreete
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.65 Rfree 0.18762
    Matthews' coefficent 2.57 Rfactor 0.15768
    Waters 295 Solvent Content 51.70

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1o54
    1. The importance of alignment accuracy for molecular replacement
    R Schwarzenbacher, A Godzik - Section D: Biological , 2004 - scripts.iucr.org
     
    2. The JCSG MR pipeline: optimized alignments, multiple models and parallel searches
    R Schwarzenbacher, A Godzik - Section D: Biological , 2007 - scripts.iucr.org
     
    3. Shotgun crystallization strategy for structural genomics II: crystallization conditions that produce high resolution structures for T. maritima proteins
    R Page, AM Deacon, SA Lesley - Journal of structural and , 2005 - Springer
     
    4. Insights into the hyperthermostability and unusual region-specificity of archaeal Pyrococcus abyssi tRNA m1A57/58 methyltransferase
    A Guelorget, M Roovers, V Gurineau - Nucleic acids , 2010 - Oxford Univ Press
     
    5. Active site identification through geometry-based and sequence profile-based calculations: burial of catalytic clefts
    R Greaves, J Warwicker - Journal of molecular biology, 2005 - Elsevier
     
    6. Structural comparison of tRNA m1A58 methyltransferases revealed different molecular strategies to maintain their oligomeric architecture under extreme
    A Guelorget, P Barraud, C Tisne - BMC Structural , 2011 - w02.biomedcentral.com
     
    7. Crystallization and preliminary X-ray diffraction crystallographic study of tRNA m1A58 methyltransferase from Saccharomyces cerevisiae
    X Qiu, K Huang, J Ma, Y Gao - Acta Crystallographica Section F: , 2011 - scripts.iucr.org
     

    Protein Summary


    The gene TM0748 from Thermotoga maritima encodes the GCD14-like subunit of the RNA methyltransferase complex PF08704 COG2519 E.C.2.1.1.62. Homologs are found in all domains of life. In eukaryotes, this complex is localized in the nucleus.  GCD14 subunit is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [Ref].  GCD14 is essential protein required for the initiation of protein synthesis and translational repression of GCN4 mRNA.

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch