.
The Open Protein Structure Annotation Network
PDB Keyword
.

1o50

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of a tandem cystathionine-beta-synthase (CBS) domain protein (TM0935) from Thermotoga maritima at 1.87 A resolution. Proteins 57 213-217 2004
    Site JCSG
    PDB Id 1o50 Target Id 282804
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1247,TM0935, 282177 Molecular Weight 16555.72 Da.
    Residues 145 Isoelectric Point 5.13
    Sequence mkvkdvcklislkptvveedtpieeivdriledpvtrtvyvardnklvgmipvmhllkvsgfhffgfip keelirssmkrliaknaseimldpvyvhmdtpleealklmidnniqempvvdekgeivgdlnsleilla lwkgrek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.87 Rfree 0.25495
    Matthews' coefficent 2.40 Rfactor 0.19113
    Waters 214 Solvent Content 48.27

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1o50
    1. CBS domains: structure, function, and pathology in human proteins
    S Ignoul, J Eggermont - American Journal of Physiology-Cell , 2005 - Am Physiological Soc
     
    2. Crystal structure of the cytoplasmic domain of the chloride channel ClC-0
    S Meyer, R Dutzler - Structure, 2006 - Elsevier
     
    3. Identification of the ligand binding sites on the molecular surface of proteins
    K Kinoshita, H Nakamura - Protein Science, 2005 - Wiley Online Library
     
    4. Microbial biochemistry, physiology, and biotechnology of hyperthermophilic Thermotoga species
    SB Conners, EF Mongodin, MR Johnson - FEMS microbiology , 2006 - Wiley Online Library
     
    5. Crystal structure of a tandem cystathionine___synthase (CBS) domain protein (TM0935) from Thermotoga maritima at 1.87 resolution
    MD Miller, R Schwarzenbacher - Proteins: Structure, , 2004 - Wiley Online Library
     
    6. Prediction of active sites for protein structures from computed chemical properties
    J Ko, LF Murga, Y Wei, MJ Ondrechen - Bioinformatics, 2005 - Oxford Univ Press
     
    7. Biochemical and Structural Characterization of a Novel Family of Cystathionine [beta]-Synthase Domain Proteins Fused to a Zn Ribbon-Like Domain
    M Proudfoot, SA Sanders, A Singer, R Zhang - Journal of molecular , 2008 - Elsevier
     
    8. Structure of the Bateman2 domain of yeast Snf4: dimeric association and relevance for AMP binding
    MJ Rudolph, GA Amodeo, SH Iram, SP Hong, G Pirino - Structure, 2007 - Elsevier
     
    9. Shotgun crystallization strategy for structural genomics II: crystallization conditions that produce high resolution structures for T. maritima proteins
    R Page, AM Deacon, SA Lesley - Journal of structural and , 2005 - Springer
     
    10. A cytoplasmic domain mutation in ClC-Kb affects long-distance communication across the membrane
    GQ Martinez, M Maduke - PLoS One, 2008 - dx.plos.org
     
    11. Structures and functional implications of an AMP-binding cystathionine _-synthase domain protein from a hyperthermophilic archaeon
    NP King, TM Lee, MR Sawaya, D Cascio - Journal of molecular , 2008 - Elsevier
     
    12. Purification, crystallization and preliminary crystallographic analysis of the CBS-domain protein MJ1004 from Methanocaldococcus jannaschii
    I Oyenarte, M Lucas, I Gomez Garcia - Section F: Structural , 2011 - scripts.iucr.org
     
    13. Carbohydrate utilization pathway analysis in the hyperthermophile Thermotoga maritima
    SB Conners - 2006 - repository.lib.ncsu.edu
     
    14. THE STruCTurAL BASiS For iNorGANiC PyroPHoSPHATASE CATALySiS AND rEGuLATioN
    H Tuominen - 2011 - doria.fi
     
    15. Functional studies on bacterial nucleotide-regulated inorganic pyrophosphatases
    J Jmsn - 2011 - doria.fi
     
    16. ABC transporter architecture and regulatory roles of accessory domains
    MK Doeven, E Biemans-Oldehinkel, B Poolman - 2006 - dissertations.ub.rug.nl
     

    Protein Summary

    Gene TM0935 from Thermotoga maritima translates in the NP_228743 protein that folds into a tandem cystathionine-beta-synthase (CBS) domain (PF00571; COG0517). CBS domains are widely distributed in all divisions of life, in the form of fusions with various unrelated proteins, where they usually form tandem pairs of about 120 aa that folds into one domain with a beta-sandwich and 4 alpha-helices extending from one edge [Ref]. Analysis of the genome context of TM0935 indicates the possible functional linkage (score 0.87) with the 5-methylthioadenosine deaminase mtaD (TM0936).

    1o50 classifies inside the alpha+beta class, CBS-domain pair (super)family. DALI top hits are with CBS domain protein PDB:2rc3 (Z=16), the MJ0100 protein PDB:3kpc (Z=16), and the YQZB protein PDB:3fv6 (Z=16).

    Functions of CBS domains are related to its ability to bind adenosyl-containing molecules to serve as energy or redox status sensing modules (PubMed: [Ref], [Ref], [Ref]). Cystathionine beta-synthase (CBS-domain containing protein) may function in oxidative stress defense by trans-sulfuration pathway [Ref], where S-adenosylmethionine stabilizes cystathionine beta-synthase and modulates redox capacity [Ref].

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    2. (No Results)

       


      Discuss this publication
    3. (No Results)

       


      Discuss this publication
    4. (No Results)

       


      Discuss this publication
    5. (No Results)

       


      Discuss this publication
    6. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch