.
The Open Protein Structure Annotation Network
PDB Keyword
.

1o4s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of an aspartate aminotransferase (TM1255) from Thermotoga maritima at 1.90 A resolution. Proteins 55 759-763 2004
    Site JCSG
    PDB Id 1o4s Target Id 283120
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1273,TM1255, 3.40.640.10, 84750, 89317 Molecular Weight 42418.71 Da.
    Residues 377 Isoelectric Point 6.81
    Sequence mvsrriseipisktmeldakakalikkgedvinltagepdfptpepvveeavrflqkgevkytdprgiy elregiakrigerykkdispdqvvvtngakqalfnafmalldpgdevivfspvwvsyipqiilaggtvn vvetfmsknfqpsleevegllvgktkavlinspnnptgvvyrrefleglvrlakkrnfyiisdevydsl vytdeftsildvsegfdrivyingfskshsmtgwrvgylissekvatavskiqshttscintvaqyaal kalevdnsymvqtfkerknfvverlkkmgvkfvepegafylffkvrgddvkfcerlleekkvalvpgsa flkpgfvrlsfatsierltealdriedflnsr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.2
    Matthews' coefficent 2.31 Rfactor 0.159
    Waters 587 Solvent Content 46.34

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1o4s
    1. The importance of alignment accuracy for molecular replacement
    R Schwarzenbacher, A Godzik - Section D: Biological , 2004 - scripts.iucr.org
     
    2. Revisit of aminotransferase in the genomic era and its application to biocatalysis
    BY Hwang, BK Cho, H Yun, K Koteshwar - Journal of Molecular , 2005 - Elsevier
     
    3. Microbial biochemistry, physiology, and biotechnology of hyperthermophilic Thermotoga species
    SB Conners, EF Mongodin, MR Johnson - FEMS microbiology , 2006 - Wiley Online Library
     
    4. Requirements for specific binding of low affinity inhibitor fragments to the SH2 domain of pp60Src are identical to those for high affinity binding of full length inhibitors
    G Lange, D Lesuisse, P Deprez, B Schoot - Journal of medicinal , 2003 - ACS Publications
     
    5. Crystal structure of LL-diaminopimelate aminotransferase from Arabidopsis thaliana: a recently discovered enzyme in the biosynthesis of L-lysine by plants and
    N Watanabe, MM Cherney, MJ van Belkum - Journal of molecular , 2007 - Elsevier
     
    6. Shotgun crystallization strategy for structural genomics II: crystallization conditions that produce high resolution structures for T. maritima proteins
    R Page, AM Deacon, SA Lesley - Journal of structural and , 2005 - Springer
     
    7. The Three-dimensional Structure of N-Succinyldiaminopimelate Aminotransferase from Mycobacterium tuberculosis
    S Weyand, G Kefala, MS Weiss - Journal of molecular biology, 2007 - Elsevier
     
    8. Clinical and mutational investigations of tyrosinemia type II in Northern Tunisia: Identification and structural characterization of two novel TAT mutations
    C Charfeddine, K Monastiri, M Mokni, A Laadjimi - Molecular genetics and , 2006 - Elsevier
     
    9. Crystal structure of an aspartate aminotransferase (TM1255) from Thermotoga maritima at 1.90 resolution
    R Schwarzenbacher, L Jaroszewski - Proteins: Structure, , 2004 - Wiley Online Library
     
    10. L, L-Diaminopimelate aminotransferase from Chlamydomonas reinhardtii: a target for algaecide development
    RCJ Dobson, I Girn, AO Hudson - PLoS One, 2011 - dx.plos.org
     
    11. Insights into the structural basis of substrate recognition by histidinol-phosphate aminotransferase from Corynebacterium glutamicum
    J Marienhagen, T Sandalova, H Sahm - Section D: Biological , 2008 - scripts.iucr.org
     
    12. In silico carborane docking to proteins and potential drug targets
    M Calvaresi, F Zerbetto - Journal of chemical information and , 2011 - ACS Publications
     
    13. Carbohydrate utilization pathway analysis in the hyperthermophile Thermotoga maritima
    SB Conners - 2006 - repository.lib.ncsu.edu
     
    14. The Enzymology of Alanine Aminotransferase (AlaAT) Isoforms from Hordeum vulgare and Other Organisms, and the HvAlaAT Crystal Structure
    SMG Duff, TJ Rydel, AL McClerren, W Zhang - Archives of Biochemistry , 2012 - Elsevier
     
    15. Microbial drug target identification using different computational approaches: Specific application to Pseudomonas aeruginosa
    D Perumal, CS Lim - Innovations in Information , 2008 - ieeexplore.ieee.org
     

    Protein Summary

    The TM1255 from T. maritima encodes aspartate aminotransferase (EC:2.6.1.1) and its paralog TM1698 belogns to COG0436 (aspartate/tyrosine/aromatic aminotransferase).

    Analysis of the crystallographic packing of TM1255 using the PQS server {Henrick, 1998 #73} indicates that a dimer is the biologically relevant form.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch