.
The Open Protein Structure Annotation Network
PDB Keyword
.

1o12

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of N-acetylglucosamine-6-phosphate deacetylase (TM0814) from Thermotoga maritima at 2.5 A resolution. To be published
    Site JCSG
    PDB Id 1o12 Target Id 282684
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1236,TM0814, 85028, 84730 Molecular Weight 40200.31 Da.
    Residues 364 Isoelectric Point 5.59
    Sequence mivekvlivdpidgeftgdveieegkivkvekreciprgvlmpgfvdphihgvvgadtmncdfsemeef lysqgvttflattvstslekmkeilrkardyilenpstsllgvhlegpyiskekkgahsekhirppser elseidspakmltfapeiesselllrlvkrdivlsaghsiatfeefmkfykegvkrithfpnglkplhh reigitgaglllddvklelicdgvhlsremvklvykvkkangivlvtdsisaaglkdgtttlgdlvvkv kdgvprledgtlagstlffsqavknfrkftgcsitelakvssynscvelglddrgriaegtradlvlld edlnvvmtikegevvfrsr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.251
    Matthews' coefficent 2.64 Rfactor 0.195
    Waters 206 Solvent Content 52.99

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1o12
    1. Predictions without templates: new folds, secondary structure, and contacts in CASP5
    P Aloy, A Stark, C Hadley - : Structure, Function, and , 2003 - Wiley Online Library
     
    2. Assessment of homology_based predictions in CASP5
    A Tramontano, V Morea - Proteins: Structure, Function, and , 2003 - Wiley Online Library
     
    3. Structural and catalytic diversity within the amidohydrolase superfamily
    CM Seibert, FM Raushel - Biochemistry, 2005 - ACS Publications
     
    4. Protein function prediction using local 3D templates
    RA Laskowski, JD Watson, JM Thornton - Journal of Molecular Biology, 2005 - Elsevier
     
    5. Leveraging enzyme structure-function relationships for functional inference and experimental design: the structure-function linkage database
    SCH Pegg, SD Brown, S Ojha, J Seffernick - Biochemistry, 2006 - ACS Publications
     
    6. Predicting protein functional sites with phylogenetic motifs
    D La, B Sutch, DR Livesay - Proteins: Structure, Function, and , 2005 - Wiley Online Library
     
    7. CASP5 target classification
    LN Kinch, Y Qi, TJP Hubbard - : Structure, Function, and , 2003 - Wiley Online Library
     
    8. Shotgun crystallization strategy for structural genomics II: crystallization conditions that produce high resolution structures for T. maritima proteins
    R Page, AM Deacon, SA Lesley - Journal of structural and , 2005 - Springer
     
    9. N-Acetyl-D-glucosamine-6-phosphate deacetylase: substrate activation via a single divalent metal ion
    S Richard, DF Xiang, C Xu, FM Raushel - Biochemistry, 2007 - ACS Publications
     
    10. Structural diversity within the mononuclear and binuclear active sites of N-acetyl-D-glucosamine-6-phosphate deacetylase
    S Richard, S Brown, AA Fedorov, EV Fedorov, C Xu - Biochemistry, 2007 - ACS Publications
     
    11. A fold-recognition approach to loop modeling
    C Levefelt, D Lundh - Journal of molecular modeling, 2006 - Springer
     
    12. A seqlet-based maximum entropy Markov approach for protein secondary structure prediction
    Q Dong, X Wang, L Lin, Y Guan - Science in China Series C: Life Sciences, 2005 - Springer
     
    13. Structural Analysis of N-acetylglucosamine-6-phosphate Deacetylase Apoenzyme from Escherichia coli
    FM Ferreira, G Mendoza-Hernandez - Journal of molecular , 2006 - Elsevier
     
    14. Gene identification and characterization of the pyridoxine degradative enzyme _-(N-acetylaminomethylene) succinic acid amidohydrolase from Mesorhizobium loti
    B Yuan, N Yokochi, Y Yoshikane, K Ohnishi - Journal of nutritional , 2008 - J-STAGE
     
    15. Protein Structure Prediction Using an Augmented Homology Modeling Method: Key Importance of Iterative-Procedures for Obtaining Consistent Quality Models
    S McDonald, S Mylvaganam - Current , 2005 - ingentaconnect.com
     
    16. Studies on the inference of protein binding regions across fold space based on structural similarities
    J Teyra, J Hawkins, H Zhu - : Structure, Function, and , 2011 - Wiley Online Library
     
    17. SCUBA Sources: Massive Galaxies at High Redshifts?
    I Smail - The Mass of Galaxies at Low and High Redshift, 2003 - Springer
     

    Protein Summary

    The TM0814 gene from Thermotoga maritima encodes N-acetylglucosamine-6-phosphate deacetylase, a member of aminohydrolase family, a subset of metal-dependent hydrolases superfamily PF01979 COG1834.  The enzyme includes the catalytic domain of urease alpha subunit homologous to that from Klebsiella aerogenes [Ref].

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch