.
The Open Protein Structure Annotation Network
PDB Keyword
.

1j5w

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Glycyl-tRNA synthetase alpha chain (TM0216) from Thermotoga maritima at 1.95 A resolution. To be published
    Site JCSG
    PDB Id 1j5w Target Id 282096
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1193,TM0216, 84846 Molecular Weight 33538.30 Da.
    Residues 286 Isoelectric Point 4.99
    Sequence mylqdvimklndfwaskgclleqpydmevgagtfhpatffgslrkgpwkvayvqpsrrptdgrygenpn rlqryfqyqviikpspensqelylesleylginlkehdirfvednwesptlgawgvgwevwldgmeitq ftyfqqiggislkdipleitygleriamylqgvdnvyevqwnenvkygdvflenerefsvfnfeeanvg llfrhfdeyekefyrlveknlylpaydyilkcshtfnlldargaisvsqrqtyvkriqamarkaarvfl evqanenspa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.95 Rfree 0.254
    Matthews' coefficent 2.27 Rfactor 0.197
    Waters 255 Solvent Content 45.49

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1j5w
    1. Statistical analysis and prediction of proteinprotein interfaces
    AJ Bordner, R Abagyan - Proteins: Structure, Function, and , 2005 - Wiley Online Library
     
    2. Alanyl-tRNA synthetase crystal structure and design for acceptor-stem recognition
    MA Swairjo, FJ Otero, XL Yang, MA Lovato, RJ Skene - Molecular cell, 2004 - Elsevier
     
    3. Characterization of interfacial solvent in protein complexes and contribution of wet spots to the interface description
    J Teyra, MT Pisabarro - Proteins: Structure, Function, and , 2007 - Wiley Online Library
     
    4. Molego_based definition of the architecture and specificity of metal_binding sites
    CH Schein, B Zhou, N Oezguen - Proteins: Structure, , 2005 - Wiley Online Library
     
    5. Prediction of active sites for protein structures from computed chemical properties
    J Ko, LF Murga, Y Wei, MJ Ondrechen - Bioinformatics, 2005 - Oxford Univ Press
     
    6. A common substrate recognition mode conserved between katanin p60 and VPS4 governs microtubule severing and membrane skeleton reorganization
    N Iwaya, Y Kuwahara, Y Fujiwara, N Goda - Journal of Biological , 2010 - ASBMB
     
    7. Crystallization and preliminary X-ray analysis of a native human tRNA synthetase whose allelic variants are associated with Charcot-Marie-Tooth disease
    W Xie, P Schimmel, XL Yang - Acta Crystallographica Section F: , 2006 - scripts.iucr.org
     

    Protein Summary


    The TM0216 from Thermotoga maritima codes for glycyl-tRNA synthetase alpha chain.  The enzyme belongs to a family of class II tRNA synthetases PF02091.  The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II COG0752.  These proteins differ widely in size and oligomeric state, and have limited sequence homology [Ref].  However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases.  In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred.

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch