.
The Open Protein Structure Annotation Network
PDB Keyword
.

1j5s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of uronate isomerase (TM0064) from Thermotoga maritima at 2.85 A resolution. Proteins 53 142-145 2003
    Site JCSG
    PDB Id 1j5s Target Id 281945
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1179,TM0064, 83921 Molecular Weight 52303.03 Da.
    Residues 451 Isoelectric Point 5.68
    Sequence mflgedylltnraavrlfnevkdlpivdphnhldakdivenkpwndiwevegatdhyvwelmrrcgvse eyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemtpqk llrdmkveilcttddpvstlehhrkakeavegvtilptwrpdramnvdkegwreyvekmgerygedtst ldgflnalwkshehfkehgcvasdhallepsvyyvdenraravhekafsgekltqdeindykafmmvqf gkmnqetnwvtqlhigalrdyrdslfktlgpdsggdistnflriaeglryflnefdgklkivlyvldpt hlptistiarafpnvyvgapwwfndspfgmemhlkylasvdllynlagmvtdsrkllsfgsrtemfrrv lsnvvgemvekgqipikearelvkhvsydgpkalffg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.85 Rfree 0.274
    Matthews' coefficent 2.81 Rfactor 0.234
    Waters 107 Solvent Content 55.94

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1j5s
    1. Structural and catalytic diversity within the amidohydrolase superfamily
    CM Seibert, FM Raushel - Biochemistry, 2005 - ACS Publications
     
    2. Locating the stabilizing residues in (_/_) 8 barrel proteins based on hydrophobicity, long_range interactions, and sequence conservation
    MM Gromiha, G Pujadas, C Magyar - Proteins: Structure, , 2004 - Wiley Online Library
     
    3. At the periphery of the amidohydrolase superfamily: Bh0493 from Bacillus halodurans catalyzes the isomerization of D-galacturonate to D-tagaturonate
    TT Nguyen, S Brown, AA Fedorov, EV Fedorov - Biochemistry, 2008 - ACS Publications
     
    4. Uronate isomerase: a nonhydrolytic member of the amidohydrolase superfamily with an ambivalent requirement for a divalent metal ion
    LK Williams, T Nguyen, Y Li, TN Porter - Biochemistry, 2006 - ACS Publications
     
    5. The Crystal Structure of a Novel, Latent Dihydroorotase from Aquifex aeolicus at 1.7 Resolution
    PD Martin, C Purcarea, P Zhang, A Vaishnav - Journal of molecular , 2005 - Elsevier
     
    6. Shotgun crystallization strategy for structural genomics II: crystallization conditions that produce high resolution structures for T. maritima proteins
    R Page, AM Deacon, SA Lesley - Journal of structural and , 2005 - Springer
     
    7. Crystal structure of uronate isomerase (TM0064) from Thermotoga maritima at 2.85 resolution
    R Schwarzenbacher, JM Canaves - Proteins: Structure, , 2003 - Wiley Online Library
     
    8. Target selection and annotation for the structural genomics of the amidohydrolase and enolase superfamilies
    U Pieper, R Chiang, JJ Seffernick, SD Brown - Journal of structural and , 2009 - Springer
     
    9. Modeling the three_dimensional structure of H+_ATPase of Neurospora crassa
    O Radresa, K Ogata, S Wodak - European Journal of , 2002 - Wiley Online Library
     
    10. High-throughput protein production for X-ray crystallography and use of size exclusion chromatography to validate or refute computational biological unit predictions
    D McMullan, JM Canaves, K Quijano - Journal of structural and , 2005 - Springer
     
    11. Are structural biases at protein termini a signature of vectorial folding?
    A Laio, C Micheletti - PROTEINS: Structure, Function, and , 2006 - Wiley Online Library
     
    12. Exploring the environmental preference of weak interactions in (_/_) 8 barrel proteins
    S Chakkaravarthi, MM Babu - PROTEINS: , 2006 - Wiley Online Library
     
    13. Analysis of chameleon sequences by energy decomposition on a pairwise per-residue basis
    S Yoon, H Jung - The protein journal, 2006 - Springer
     
    14. Protein function prediction by matching 3d structural data
    CC Chen, JT Tu, PK Chang, BY Chen - Proceedings of , 2004 - cmlab.csie.ntu.edu.tw
     
    15. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     

    Protein Summary

    The TM0064 gene of Thermotoga maritima encodes a predicted uronate isomerase (EC:5.3.1.12; COG:COG1904; PFAM:PF02614). This enzyme catalyses the reactions: D-glucuronate <=> D-fructuronate and D-galacturonate <=> D-tagaturonate.

     

    1j5s structure folds into a TIM beta/alpha-barrel (SCOP sunid:51350) with all-alpha subdomain inserted after the first strand. The all-alpha subdomain has a novel fold, unique for uronate isomerase-like family (SCOP sunid:75082) [Ref].

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch