The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative C-S lyase from Bacillus anthracis. To be Published
    Site CSGID
    PDB Id 3kax Target Id IDP01723
    Molecular Characteristics
    Source Bacillus anthracis str. ames ancestor
    Alias Ids TPS31284,261594, 47530443 Molecular Weight 43994.20 Da.
    Residues 383 Isoelectric Point 5.93
    Sequence mqlfhktvnrrgthsikwdtykneelihawiadmdfevpqpiqtalkkriehpifgytlppenigdiic nwtkkqynwdiqkewivfsagivpalstsiqaftkenesvlvqppiyppffemvttnnrqlcvsplqkq ndtyaidfehlekqfqqgvklmllcsphnpigrvwkkeeltklgslctkynvivvadeihsdiiyadht htpfaslseelaartitcmapsktfniaglqasiiiipneklrqaftsiqyrqgfhglnifaytamqsa ytecndwlneirfyiednakfaceyikdhiptlsvmkpegsfllwidcsalnlsqdertklleekgkii vepgekyglggeehiginigcprsvleeilnrlrhtfs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.215
    Matthews' coefficent 2.20 Rfactor 0.179
    Waters 763 Solvent Content 44.17

    Ligand Information
    Metals NA (SODIUM) x 3


    Google Scholar output for 3kax

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch